Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4177093..4177715 | Replicon | chromosome |
Accession | NZ_LT222319 | ||
Organism | Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A658PBH1 |
Locus tag | PCPL58_RS20920 | Protein ID | WP_003434313.1 |
Coordinates | 4177533..4177715 (-) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A193SSY5 |
Locus tag | PCPL58_RS20915 | Protein ID | WP_024661723.1 |
Coordinates | 4177093..4177497 (-) | Length | 135 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PCPL58_RS20900 | 4172859..4173527 | + | 669 | WP_065350359.1 | ABC transporter ATP-binding protein | - |
PCPL58_RS20905 | 4173527..4176007 | + | 2481 | WP_065350360.1 | ABC transporter permease | - |
PCPL58_RS20910 | 4175997..4177076 | + | 1080 | WP_065350361.1 | iron ABC transporter permease | - |
PCPL58_RS20915 | 4177093..4177497 | - | 405 | WP_024661723.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
PCPL58_RS20920 | 4177533..4177715 | - | 183 | WP_003434313.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
PCPL58_RS20925 | 4177999..4179771 | + | 1773 | WP_024661722.1 | N-acetylglutaminylglutamine amidotransferase | - |
PCPL58_RS20930 | 4179775..4181523 | + | 1749 | WP_024661721.1 | N-acetylglutaminylglutamine synthetase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6777.99 Da Isoelectric Point: 10.6643
>T293124 WP_003434313.1 NZ_LT222319:c4177715-4177533 [Pseudomonas cerasi]
VQSRQLIKELEADGWILDRVSGSHHMFKHPEKLQTVPVPHPKKDLPFGTVRAIKKLAGLV
VQSRQLIKELEADGWILDRVSGSHHMFKHPEKLQTVPVPHPKKDLPFGTVRAIKKLAGLV
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14345.43 Da Isoelectric Point: 5.1643
>AT293124 WP_024661723.1 NZ_LT222319:c4177497-4177093 [Pseudomonas cerasi]
MKYPMCIEWGSETTAFGIQIPDIPGAVTAGDTFEEAHAAAVEIAHIMLQEIAAGGGTIPKAGTVAEHARNADFAGMGWGM
IEIDVTPYLGKTEKVNVTLPGFVIKQIDRYVRDHSIKSRSTFLADAALEKLGRA
MKYPMCIEWGSETTAFGIQIPDIPGAVTAGDTFEEAHAAAVEIAHIMLQEIAAGGGTIPKAGTVAEHARNADFAGMGWGM
IEIDVTPYLGKTEKVNVTLPGFVIKQIDRYVRDHSIKSRSTFLADAALEKLGRA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A658PBH1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A193SSY5 |