Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 913030..913664 Replicon chromosome
Accession NZ_LT222319
Organism Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf

Toxin (Protein)


Gene name vapC Uniprot ID A0A193SM35
Locus tag PCPL58_RS06625 Protein ID WP_003345997.1
Coordinates 913030..913434 (-) Length 135 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A193SK58
Locus tag PCPL58_RS06630 Protein ID WP_065349081.1
Coordinates 913434..913664 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PCPL58_RS06595 908813..909295 + 483 WP_003345989.1 PAS domain-containing protein -
PCPL58_RS06600 909392..910648 + 1257 WP_004402530.1 3-phosphoshikimate 1-carboxyvinyltransferase -
PCPL58_RS06605 910671..911333 - 663 WP_003421647.1 ChrR family anti-sigma-E factor -
PCPL58_RS06610 911333..911845 - 513 WP_024663314.1 sigma-70 family RNA polymerase sigma factor -
PCPL58_RS06615 912081..912269 - 189 WP_024663313.1 hypothetical protein -
PCPL58_RS06620 912268..912843 + 576 WP_024663312.1 hypothetical protein -
PCPL58_RS06625 913030..913434 - 405 WP_003345997.1 tRNA(fMet)-specific endonuclease VapC Toxin
PCPL58_RS06630 913434..913664 - 231 WP_065349081.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
PCPL58_RS06635 913781..914662 - 882 WP_065349082.1 aldose 1-epimerase -
PCPL58_RS06640 914637..915608 - 972 WP_024649225.1 DMT family transporter -
PCPL58_RS06645 915693..916973 - 1281 WP_065349083.1 TRAP transporter large permease -
PCPL58_RS06650 916974..917501 - 528 WP_003408544.1 TRAP transporter small permease -
PCPL58_RS06655 917565..918590 - 1026 WP_024693616.1 TRAP transporter substrate-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-125)

Antitoxin

SpoVT-AbrB domain

(7-34)


Sequences

Toxin        


Download         Length: 135 a.a.        Molecular weight: 14946.21 Da        Isoelectric Point: 6.8620

>T293123 WP_003345997.1 NZ_LT222319:c913434-913030 [Pseudomonas cerasi]
MLKYMLDTNICIFTIKNKPTSVREAFNLHHGQLCISAITLMELVYGAEKSLSPERNLAVVEGFTARLEVLPYDSDAAAHT
GMIRAELARSGTPIGPYDQMIAGHARSLGLVVITNNQREFRRVEGLRVEDWVSQ

Download         Length: 405 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8579.60 Da        Isoelectric Point: 4.7405

>AT293123 WP_065349081.1 NZ_LT222319:c913664-913434 [Pseudomonas cerasi]
MEQSTVFKSNRSQAVRLPKAVALPNDVKRVDVVAVGRTRIISPAGEMWNSWFDGESVSDDFMAEREQPAEQQRESL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A193SM35

Antitoxin

Source ID Structure
AlphaFold DB A0A193SK58

References