Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RelE-RHH
Location 8319..8866 Replicon plasmid p58T6
Accession NZ_LT222318
Organism Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf

Toxin (Protein)


Gene name relE Uniprot ID A0A193SHA4
Locus tag PCPL58_RS02420 Protein ID WP_057425920.1
Coordinates 8319..8594 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID H1ZWV1
Locus tag PCPL58_RS02425 Protein ID WP_015060662.1
Coordinates 8594..8866 (-) Length 91 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PCPL58_RS28870 3819..4112 + 294 WP_003348565.1 type II toxin-antitoxin system RelE/ParE family toxin -
PCPL58_RS02395 4224..5033 - 810 WP_005741073.1 IS21-like element ISPsy4 family helper ATPase IstB -
PCPL58_RS02400 5030..6052 - 1023 WP_002551322.1 IS21-like element ISPsy4 family transposase -
PCPL58_RS02405 6220..6747 + 528 WP_003348567.1 hypothetical protein -
PCPL58_RS02410 6744..7418 - 675 WP_080269136.1 MobA/MobL family protein -
PCPL58_RS02415 7631..7903 - 273 WP_065348728.1 arylsulfatase regulator -
PCPL58_RS28875 7999..8235 - 237 Protein_10 recombinase family protein -
PCPL58_RS02420 8319..8594 - 276 WP_057425920.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
PCPL58_RS02425 8594..8866 - 273 WP_015060662.1 ribbon-helix-helix domain-containing protein Antitoxin
PCPL58_RS28880 9113..9631 + 519 WP_083188299.1 GNAT family N-acetyltransferase -
PCPL58_RS02430 9714..10145 + 432 WP_065348729.1 DUF1198 family protein -
PCPL58_RS02435 10254..10814 + 561 WP_065348730.1 recombinase family protein -
PCPL58_RS28885 10818..11006 + 189 Protein_16 DUF4158 domain-containing protein -
PCPL58_RS28890 11004..11168 - 165 Protein_17 IS5/IS1182 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..11314 11314
- inside IScluster/Tn - - 4224..10814 6590


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(10-47)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10737.30 Da        Isoelectric Point: 7.0126

>T293122 WP_057425920.1 NZ_LT222318:c8594-8319 [Pseudomonas cerasi]
MELKWTSKALSDITRLYEFLALANQPAAARVVQQLTTAPTTLLTNPRIGERLEEFEPKDVRRIQIGQYEMRYEVADSTIY
LLRLWHTREDR

Download         Length: 276 bp

Antitoxin


Download         Length: 91 a.a.        Molecular weight: 10076.40 Da        Isoelectric Point: 5.6994

>AT293122 WP_015060662.1 NZ_LT222318:c8866-8594 [Pseudomonas cerasi]
MATTAKTRSVTAHVPVQLAEKVDLMAERLERSKNWIVKQALSAWIDQEEERSRLTREALADVDAGRVIDHQAVQAWADSL
STDTPLPVPR

Download         Length: 273 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A193SHA4

Antitoxin

Source ID Structure
AlphaFold DB A0A3M4CJB9

References