Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
| Location | 76359..76939 | Replicon | plasmid p58T1 |
| Accession | NZ_LT222313 | ||
| Organism | Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A2G4CV40 |
| Locus tag | PCPL58_RS00390 | Protein ID | WP_044322659.1 |
| Coordinates | 76640..76939 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A2G4CUT8 |
| Locus tag | PCPL58_RS00385 | Protein ID | WP_003407168.1 |
| Coordinates | 76359..76643 (-) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PCPL58_RS00360 | 72564..73649 | - | 1086 | WP_002556026.1 | DUF3616 domain-containing protein | - |
| PCPL58_RS00365 | 73800..74021 | + | 222 | WP_004666801.1 | hypothetical protein | - |
| PCPL58_RS28560 | 74585..75603 | - | 1019 | Protein_76 | tyrosine protein phosphatase | - |
| PCPL58_RS00380 | 75976..76284 | + | 309 | WP_181135240.1 | DUF4113 domain-containing protein | - |
| PCPL58_RS00385 | 76359..76643 | - | 285 | WP_003407168.1 | putative addiction module antidote protein | Antitoxin |
| PCPL58_RS00390 | 76640..76939 | - | 300 | WP_044322659.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PCPL58_RS00395 | 77449..77865 | + | 417 | WP_044322716.1 | hypothetical protein | - |
| PCPL58_RS30395 | 77874..78107 | - | 234 | WP_134931282.1 | hypothetical protein | - |
| PCPL58_RS00405 | 78261..78914 | + | 654 | WP_044322644.1 | AAA family ATPase | - |
| PCPL58_RS00410 | 79003..79254 | + | 252 | WP_003348789.1 | ribbon-helix-helix protein, CopG family | - |
| PCPL58_RS00415 | 79518..80135 | + | 618 | WP_065348578.1 | SOS response-associated peptidase | - |
| PCPL58_RS28570 | 80326..81004 | + | 679 | Protein_85 | tyrosine-type recombinase/integrase | - |
| PCPL58_RS00425 | 81067..81876 | - | 810 | WP_005741073.1 | IS21-like element ISPsy4 family helper ATPase IstB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..101345 | 101345 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11170.80 Da Isoelectric Point: 9.9231
>T293120 WP_044322659.1 NZ_LT222313:c76939-76640 [Pseudomonas cerasi]
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKKLADQWWQE
MTTIKQTSTYMAWERRLKDQKAKAAIAARIFRVANGLMGDVSPVGQGVSELRIHVGPGYRVYFQQRGDELILLLCGGDKS
SQSRDIETAKKLADQWWQE
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G4CV40 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2G4CUT8 |