Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE-Phd |
Location | 34870..35481 | Replicon | plasmid p58T1 |
Accession | NZ_LT222313 | ||
Organism | Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A193SFX2 |
Locus tag | PCPL58_RS00185 | Protein ID | WP_065348564.1 |
Coordinates | 34870..35220 (-) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | Q6VE98 |
Locus tag | PCPL58_RS00190 | Protein ID | WP_011152898.1 |
Coordinates | 35233..35481 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PCPL58_RS00170 | 30992..33757 | + | 2766 | WP_065348562.1 | RHS repeat-associated core domain-containing protein | - |
PCPL58_RS00175 | 33754..34161 | + | 408 | WP_065348563.1 | hypothetical protein | - |
PCPL58_RS00180 | 34359..34763 | + | 405 | WP_065348582.1 | DUF4279 domain-containing protein | - |
PCPL58_RS00185 | 34870..35220 | - | 351 | WP_065348564.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PCPL58_RS00190 | 35233..35481 | - | 249 | WP_011152898.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PCPL58_RS00195 | 35813..36775 | + | 963 | WP_065348565.1 | tyrosine-type recombinase/integrase | - |
PCPL58_RS00200 | 37174..37469 | - | 296 | Protein_41 | multicopper oxidase domain-containing protein | - |
PCPL58_RS00205 | 37671..38066 | - | 396 | WP_065348566.1 | DUF305 domain-containing protein | - |
PCPL58_RS00210 | 38398..38601 | + | 204 | WP_005782502.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..101345 | 101345 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12947.79 Da Isoelectric Point: 4.1953
>T293119 WP_065348564.1 NZ_LT222313:c35220-34870 [Pseudomonas cerasi]
MNTFALRFTEVAQQSIEDQVEHLAITQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPM
MNTFALRFTEVAQQSIEDQVEHLAITQGFSSAAQRIDTLIDAIQDKLLSTPLGYPVSPQLSELGVLHYRELNTDGYRIFY
EVMDSDGITDIAVLLVLGGKQSVEQALIRYCLLQPM
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A193SFX2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7V8LY57 |