Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapB(antitoxin)
Location 16437..17011 Replicon plasmid p58T1
Accession NZ_LT222313
Organism Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf

Toxin (Protein)


Gene name vapC Uniprot ID A0A193SFU9
Locus tag PCPL58_RS00100 Protein ID WP_065348555.1
Coordinates 16437..16814 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A8B3GLI3
Locus tag PCPL58_RS00105 Protein ID WP_020309477.1
Coordinates 16811..17011 (-) Length 67 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PCPL58_RS00080 12014..14158 + 2145 WP_065348553.1 DotA/TraY family protein -
PCPL58_RS00085 14261..14506 + 246 WP_003344389.1 hypothetical protein -
PCPL58_RS00090 14503..15153 + 651 WP_065348554.1 plasmid IncI1-type surface exclusion protein ExcA -
PCPL58_RS00095 15245..16447 + 1203 WP_020325421.1 hypothetical protein -
PCPL58_RS00100 16437..16814 - 378 WP_065348555.1 type II toxin-antitoxin system VapC family toxin Toxin
PCPL58_RS00105 16811..17011 - 201 WP_020309477.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
PCPL58_RS00110 17103..18188 + 1086 WP_065348556.1 thioredoxin fold domain-containing protein -
PCPL58_RS00115 18175..20382 + 2208 WP_065348557.1 type IV secretory system conjugative DNA transfer family protein -
PCPL58_RS00120 20995..21660 + 666 WP_065348558.1 type III effector AvrRps4 -
PCPL58_RS30385 21816..21980 + 165 WP_004666862.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..101345 101345


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Bacterial antitoxin of type II TA system, VapB

(1-43)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13646.81 Da        Isoelectric Point: 6.4728

>T293118 WP_065348555.1 NZ_LT222313:c16814-16437 [Pseudomonas cerasi]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRLSTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVEMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH

Download         Length: 378 bp

Antitoxin


Download         Length: 67 a.a.        Molecular weight: 7415.64 Da        Isoelectric Point: 7.0102

>AT293118 WP_020309477.1 NZ_LT222313:c17011-16811 [Pseudomonas cerasi]
MRTTVTIDDALYQRALEVADPAMDKADLFREAVQTFVRIQAAKRLMALGATLPAMEDIARRHEKAL

Download         Length: 201 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A193SFU9

Antitoxin

Source ID Structure
AlphaFold DB A0A8B3GLI3

References