Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
| Location | 16437..17011 | Replicon | plasmid p58T1 |
| Accession | NZ_LT222313 | ||
| Organism | Pseudomonas cerasi isolate Sour cherry (Prunus cerasus) symptomatic leaf | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | A0A193SFU9 |
| Locus tag | PCPL58_RS00100 | Protein ID | WP_065348555.1 |
| Coordinates | 16437..16814 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A8B3GLI3 |
| Locus tag | PCPL58_RS00105 | Protein ID | WP_020309477.1 |
| Coordinates | 16811..17011 (-) | Length | 67 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PCPL58_RS00080 | 12014..14158 | + | 2145 | WP_065348553.1 | DotA/TraY family protein | - |
| PCPL58_RS00085 | 14261..14506 | + | 246 | WP_003344389.1 | hypothetical protein | - |
| PCPL58_RS00090 | 14503..15153 | + | 651 | WP_065348554.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| PCPL58_RS00095 | 15245..16447 | + | 1203 | WP_020325421.1 | hypothetical protein | - |
| PCPL58_RS00100 | 16437..16814 | - | 378 | WP_065348555.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| PCPL58_RS00105 | 16811..17011 | - | 201 | WP_020309477.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| PCPL58_RS00110 | 17103..18188 | + | 1086 | WP_065348556.1 | thioredoxin fold domain-containing protein | - |
| PCPL58_RS00115 | 18175..20382 | + | 2208 | WP_065348557.1 | type IV secretory system conjugative DNA transfer family protein | - |
| PCPL58_RS00120 | 20995..21660 | + | 666 | WP_065348558.1 | type III effector AvrRps4 | - |
| PCPL58_RS30385 | 21816..21980 | + | 165 | WP_004666862.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..101345 | 101345 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13646.81 Da Isoelectric Point: 6.4728
>T293118 WP_065348555.1 NZ_LT222313:c16814-16437 [Pseudomonas cerasi]
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRLSTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVEMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
VKGVLVDTSVWVEHFRNNSPELVNLLSQDRVLIHPMVIGELACGTPPDRLSTLTDLGDLRGAQQPTVSEVIAFLNTHKLY
GLGCGLVEMTLLASALLSGTALWTLDKRLERLASRMAVSYQPPTH
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A193SFU9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B3GLI3 |