Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2751477..2752039 | Replicon | chromosome |
Accession | NZ_LT220504 | ||
Organism | Lacticaseibacillus rhamnosus strain BPL5 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | C2JYM4 |
Locus tag | BN3853_RS12910 | Protein ID | WP_005692155.1 |
Coordinates | 2751692..2752039 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | BN3853_RS12905 | Protein ID | WP_014571589.1 |
Coordinates | 2751477..2751692 (+) | Length | 72 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN3853_RS12895 | 2747768..2749558 | + | 1791 | WP_061713737.1 | ABC transporter ATP-binding protein/permease | - |
BN3853_RS12900 | 2749545..2751380 | + | 1836 | WP_015764721.1 | ABC transporter ATP-binding protein/permease | - |
BN3853_RS12905 | 2751477..2751692 | + | 216 | WP_014571589.1 | hypothetical protein | Antitoxin |
BN3853_RS12910 | 2751692..2752039 | + | 348 | WP_005692155.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
BN3853_RS15205 | 2752562..2752705 | - | 144 | WP_015764720.1 | hypothetical protein | - |
BN3853_RS12915 | 2752885..2753553 | + | 669 | WP_005692157.1 | tRNA ligase | - |
BN3853_RS12920 | 2753794..2754612 | + | 819 | WP_014571588.1 | ABC transporter permease subunit | - |
BN3853_RS12925 | 2754605..2755306 | + | 702 | WP_005692159.1 | ABC transporter ATP-binding protein | - |
BN3853_RS12930 | 2755303..2756544 | + | 1242 | WP_005692160.1 | acyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13150.01 Da Isoelectric Point: 7.9817
>T293117 WP_005692155.1 NZ_LT220504:2751692-2752039 [Lacticaseibacillus rhamnosus]
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
MTYKAKQGDVVWLDFDPSEGHEIRKRCPAVVLSSNAYNRATGFVIVAPITSTIRTLPGYVDIVSNKIRGQVVTSQVYSLD
VTEQGNRKIDFIERMNIEDFYTVAQFTKMNFDFKF
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|