Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-dinJ/YafQ-DinJ |
Location | 1389522..1390054 | Replicon | chromosome |
Accession | NZ_LT220504 | ||
Organism | Lacticaseibacillus rhamnosus strain BPL5 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | BN3853_RS06385 | Protein ID | WP_061713660.1 |
Coordinates | 1389522..1389806 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | dinJ | Uniprot ID | - |
Locus tag | BN3853_RS06390 | Protein ID | WP_061713661.1 |
Coordinates | 1389803..1390054 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
BN3853_RS06370 | 1386534..1387718 | - | 1185 | WP_005713641.1 | methionine adenosyltransferase | - |
BN3853_RS06375 | 1387897..1388550 | + | 654 | WP_005688600.1 | hypothetical protein | - |
BN3853_RS06385 | 1389522..1389806 | - | 285 | WP_061713660.1 | type II toxin-antitoxin system YafQ family toxin | Toxin |
BN3853_RS06390 | 1389803..1390054 | - | 252 | WP_061713661.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
BN3853_RS06395 | 1390108..1391406 | - | 1299 | WP_061713662.1 | LysM peptidoglycan-binding domain-containing protein | - |
BN3853_RS06400 | 1391417..1391830 | - | 414 | WP_005714728.1 | phage holin | - |
BN3853_RS06405 | 1391845..1392120 | - | 276 | WP_003581984.1 | hypothetical protein | - |
BN3853_RS14695 | 1392176..1392319 | - | 144 | WP_005688592.1 | XkdX family protein | - |
BN3853_RS06410 | 1392316..1392645 | - | 330 | WP_005711092.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10783.56 Da Isoelectric Point: 8.7304
>T293113 WP_061713660.1 NZ_LT220504:c1389806-1389522 [Lacticaseibacillus rhamnosus]
VSLLKLKYTHSAKKQLKKINLSSEDKDCLEKCLDSLCVGKELPKRYHDHSLSGNWINHREFHLRPNLLVIYSIDGEELIL
TVVAVGRHHNLLGI
VSLLKLKYTHSAKKQLKKINLSSEDKDCLEKCLDSLCVGKELPKRYHDHSLSGNWINHREFHLRPNLLVIYSIDGEELIL
TVVAVGRHHNLLGI
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|