Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /HTH_19(antitoxin)
Location 884007..884798 Replicon chromosome
Accession NZ_LT009690
Organism Staphylococcus aureus strain NZAK3

Toxin (Protein)


Gene name - Uniprot ID -
Locus tag NZAK3_RS04365 Protein ID WP_031783010.1
Coordinates 884007..884471 (-) Length 155 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A0E7YIA0
Locus tag NZAK3_RS04370 Protein ID WP_000333630.1
Coordinates 884484..884798 (-) Length 105 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NZAK3_RS04340 879692..880156 + 465 WP_001010508.1 SUF system NifU family Fe-S cluster assembly protein -
NZAK3_RS04345 880307..881704 + 1398 WP_001074405.1 Fe-S cluster assembly protein SufB -
NZAK3_RS04350 881772..882821 - 1050 WP_061713839.1 site-specific integrase -
NZAK3_RS04355 882933..883133 + 201 WP_000143212.1 excisionase -
NZAK3_RS04360 883070..883975 - 906 WP_000391592.1 hypothetical protein -
NZAK3_RS04365 884007..884471 - 465 WP_031783010.1 toxin Toxin
NZAK3_RS04370 884484..884798 - 315 WP_000333630.1 helix-turn-helix domain-containing protein Antitoxin
NZAK3_RS04375 884950..885186 + 237 WP_001121116.1 helix-turn-helix domain-containing protein -
NZAK3_RS04380 885200..885403 + 204 WP_000394020.1 hypothetical protein -
NZAK3_RS04385 885591..886370 + 780 WP_029625612.1 phage antirepressor KilAC domain-containing protein -
NZAK3_RS04390 886371..886595 + 225 WP_061713840.1 hypothetical protein -
NZAK3_RS04395 886635..887084 + 450 WP_061713841.1 hypothetical protein -
NZAK3_RS04400 887098..887319 + 222 WP_061713842.1 hypothetical protein -
NZAK3_RS04405 887312..887482 + 171 WP_000048123.1 DUF1270 domain-containing protein -
NZAK3_RS04410 887487..887801 + 315 WP_040968664.1 helix-turn-helix transcriptional regulator -
NZAK3_RS04415 887865..888125 + 261 WP_061713843.1 DUF1108 family protein -
NZAK3_RS04420 888140..888619 + 480 WP_000002516.1 siphovirus Gp157 family protein -
NZAK3_RS04425 888619..889392 + 774 WP_061713844.1 AAA family ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 880307..927929 47622
- inside Prophage - - 879692..927929 48237


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.


Antitoxin

Cro/C1-type helix-turn-helix domain

(4-62)


Sequences

Toxin        


Download         Length: 155 a.a.        Molecular weight: 18142.50 Da        Isoelectric Point: 4.7927

>T293100 WP_031783010.1 NZ_LT009690:c884471-884007 [Staphylococcus aureus]
MGLYEETLIQHDYIEVREADVLPDNLDGVWLGDLILIKRGLSDREKAGILFEELAHNKLTYGDIADYSKFNNRKFENYAR
RHGFISAVPLREIVEAYNYGVRNLYELSEYLQLSEEYILEAIEQYKKIYGIGTHYGEYSITFEPLRVFKLHHID

Download         Length: 465 bp

Antitoxin


Download         Length: 105 a.a.        Molecular weight: 12063.56 Da        Isoelectric Point: 6.4736

>AT293100 WP_000333630.1 NZ_LT009690:c884798-884484 [Staphylococcus aureus]
MCFSKRMKQSREKQGMTLAELGRKIGKTEATVQRYESGNIKNLKNDTIESIATALNVNPAYLMGWVEENDDEVQHRAAHL
EGELTDDEWQRVLDYADYIRSKRK

Download         Length: 315 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0E7YIA0

References