Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | TscAT/- |
| Location | 833728..834257 | Replicon | chromosome |
| Accession | NZ_LT009690 | ||
| Organism | Staphylococcus aureus strain NZAK3 | ||
Toxin (Protein)
| Gene name | TscT | Uniprot ID | K7ZRX6 |
| Locus tag | NZAK3_RS04045 | Protein ID | WP_001103939.1 |
| Coordinates | 833940..834257 (+) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | TscA | Uniprot ID | X5IY59 |
| Locus tag | NZAK3_RS04040 | Protein ID | WP_001058494.1 |
| Coordinates | 833728..833937 (+) | Length | 70 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NZAK3_RS04005 | 830058..830522 | + | 465 | WP_001085183.1 | SsrA-binding protein SmpB | - |
| NZAK3_RS04015 | 831085..832191 | - | 1107 | WP_000149511.1 | site-specific integrase | - |
| NZAK3_RS04020 | 832181..832984 | - | 804 | WP_000358990.1 | helix-turn-helix domain-containing protein | - |
| NZAK3_RS04025 | 833120..833323 | + | 204 | WP_001045296.1 | transcriptional regulator | - |
| NZAK3_RS04030 | 833359..833577 | + | 219 | WP_000163544.1 | helix-turn-helix domain-containing protein | - |
| NZAK3_RS04035 | 833589..833735 | + | 147 | WP_000784885.1 | hypothetical protein | - |
| NZAK3_RS04040 | 833728..833937 | + | 210 | WP_001058494.1 | hypothetical protein | Antitoxin |
| NZAK3_RS04045 | 833940..834257 | + | 318 | WP_001103939.1 | DUF1474 family protein | Toxin |
| NZAK3_RS04050 | 834321..835190 | + | 870 | WP_001002717.1 | primase alpha helix C-terminal domain-containing protein | - |
| NZAK3_RS04055 | 835207..836664 | + | 1458 | WP_000390453.1 | virulence-associated E family protein | - |
| NZAK3_RS04060 | 836965..837327 | + | 363 | WP_001039170.1 | hypothetical protein | - |
| NZAK3_RS04065 | 837329..837613 | + | 285 | WP_000998185.1 | hypothetical protein | - |
| NZAK3_RS04070 | 837610..838251 | + | 642 | WP_001019808.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12547.17 Da Isoelectric Point: 5.0161
>T293098 WP_001103939.1 NZ_LT009690:833940-834257 [Staphylococcus aureus]
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE
MNWEIKDLMCDIEVIKQKINDVATKHAWFVEDRFVKNELETKREHINFSASYLEHRIQNEHTVELLHVYLKEFGELIQKF
HEIEKASSENFGEVSDDAQKLKITE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|