Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 17548..18070 Replicon plasmid 4
Accession NZ_LS999563
Organism Escherichia coli isolate EC-TO143

Toxin (Protein)


Gene name relE Uniprot ID A9LK42
Locus tag ECTO143_RS26540 Protein ID WP_000220562.1
Coordinates 17789..18070 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag ECTO143_RS26535 Protein ID WP_000121743.1
Coordinates 17548..17799 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO143_RS26495 12597..12827 + 231 WP_000051064.1 partitioning protein -
ECTO143_RS26500 12843..13154 + 312 WP_000360321.1 hypothetical protein -
ECTO143_RS26505 13192..13812 + 621 WP_115456261.1 hypothetical protein -
ECTO143_RS26510 13984..14472 + 489 WP_001567305.1 hypothetical protein -
ECTO143_RS26515 14503..14925 - 423 WP_001467132.1 DNA distortion polypeptide 3 -
ECTO143_RS26520 14993..15439 - 447 WP_001074382.1 hypothetical protein -
ECTO143_RS26525 15479..16315 - 837 WP_001802123.1 replication initiation protein -
ECTO143_RS26535 17548..17799 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
ECTO143_RS26540 17789..18070 + 282 WP_000220562.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ECTO143_RS26545 18216..18539 + 324 WP_001181905.1 hypothetical protein -
ECTO143_RS26550 18587..18832 + 246 WP_000356542.1 hypothetical protein -
ECTO143_RS26555 18822..19037 + 216 WP_001180117.1 hypothetical protein -
ECTO143_RS26560 19130..19459 + 330 WP_000866654.1 hypothetical protein -
ECTO143_RS26565 19502..19681 + 180 WP_000439079.1 hypothetical protein -
ECTO143_RS27110 19751..19900 + 150 WP_000003879.1 hypothetical protein -
ECTO143_RS26570 19913..20185 + 273 WP_000160399.1 hypothetical protein -
ECTO143_RS27265 20498..20572 + 75 Protein_30 DNA distortion polypeptide 3 -
ECTO143_RS26575 20567..21112 + 546 WP_020801480.1 hypothetical protein -
ECTO143_RS26580 21115..22281 + 1167 WP_052928917.1 relaxase/mobilization nuclease domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..55148 55148


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(6-82)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11021.83 Da        Isoelectric Point: 10.5938

>T293096 WP_000220562.1 NZ_LS999563:17789-18070 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVISVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT293096 WP_000121743.1 NZ_LS999563:17548-17799 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A9LK42

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References