Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 47276..47919 | Replicon | plasmid 2 |
Accession | NZ_LS999561 | ||
Organism | Escherichia coli isolate EC-TO143 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | C7S9Y5 |
Locus tag | ECTO143_RS25155 | Protein ID | WP_001034046.1 |
Coordinates | 47276..47692 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | V0SR71 |
Locus tag | ECTO143_RS25160 | Protein ID | WP_001261278.1 |
Coordinates | 47689..47919 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO143_RS25140 | 42413..42829 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
ECTO143_RS25145 | 42826..43056 | - | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
ECTO143_RS25150 | 43437..47231 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
ECTO143_RS25155 | 47276..47692 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ECTO143_RS25160 | 47689..47919 | - | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
ECTO143_RS25165 | 48184..48684 | + | 501 | WP_000528932.1 | hypothetical protein | - |
ECTO143_RS25170 | 48697..49470 | + | 774 | WP_000905949.1 | hypothetical protein | - |
ECTO143_RS25175 | 49681..51294 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
ECTO143_RS25180 | 51325..51675 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
ECTO143_RS25185 | 51672..52097 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | sitABCD | - | 1..134692 | 134692 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T293083 WP_001034046.1 NZ_LS999561:c47692-47276 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9NXF9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | V0SR71 |