Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4295913..4296748 | Replicon | chromosome |
Accession | NZ_LS999560 | ||
Organism | Escherichia coli isolate EC-TO143 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
Locus tag | ECTO143_RS21365 | Protein ID | WP_000854759.1 |
Coordinates | 4295913..4296290 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1NM52 |
Locus tag | ECTO143_RS21370 | Protein ID | WP_001295723.1 |
Coordinates | 4296380..4296748 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO143_RS21340 | 4292024..4293664 | - | 1641 | WP_001332039.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
ECTO143_RS21345 | 4294437..4294613 | - | 177 | Protein_4095 | helix-turn-helix domain-containing protein | - |
ECTO143_RS27205 | 4294977..4295135 | - | 159 | WP_001467148.1 | hypothetical protein | - |
ECTO143_RS21355 | 4295235..4295411 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
ECTO143_RS21360 | 4295428..4295916 | - | 489 | WP_000761690.1 | hypothetical protein | - |
ECTO143_RS21365 | 4295913..4296290 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
ECTO143_RS21370 | 4296380..4296748 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
ECTO143_RS21375 | 4296911..4297132 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
ECTO143_RS21380 | 4297195..4297671 | - | 477 | WP_001186775.1 | RadC family protein | - |
ECTO143_RS21385 | 4297687..4298160 | - | 474 | WP_001350782.1 | antirestriction protein | - |
ECTO143_RS21395 | 4298502..4299320 | - | 819 | WP_001234738.1 | DUF945 domain-containing protein | - |
ECTO143_RS21405 | 4299475..4299633 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4283452..4313528 | 30076 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T293078 WP_000854759.1 NZ_LS999560:c4296290-4295913 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT293078 WP_001295723.1 NZ_LS999560:c4296748-4296380 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J2AEA6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1NM52 |