Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4103868..4104388 Replicon chromosome
Accession NZ_LS999560
Organism Escherichia coli isolate EC-TO143

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag ECTO143_RS20435 Protein ID WP_001160964.1
Coordinates 4103868..4104152 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag ECTO143_RS20440 Protein ID WP_000125566.1
Coordinates 4104155..4104388 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO143_RS20410 4099513..4100799 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
ECTO143_RS20415 4100799..4101788 + 990 WP_134089470.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
ECTO143_RS20420 4101785..4102606 + 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
ECTO143_RS20425 4102609..4102986 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
ECTO143_RS20430 4102993..4103841 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
ECTO143_RS20435 4103868..4104152 - 285 WP_001160964.1 CcdB family protein Toxin
ECTO143_RS20440 4104155..4104388 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
ECTO143_RS20445 4104474..4104953 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
ECTO143_RS20450 4105145..4107007 - 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
ECTO143_RS20455 4107000..4107530 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
ECTO143_RS20460 4107638..4108969 - 1332 WP_001183209.1 MFS transporter -
ECTO143_RS20465 4109028..4109315 - 288 WP_000203744.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T293075 WP_001160964.1 NZ_LS999560:c4104152-4103868 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT293075 WP_000125566.1 NZ_LS999560:c4104388-4104155 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References