Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3652956..3653574 | Replicon | chromosome |
| Accession | NZ_LS999560 | ||
| Organism | Escherichia coli isolate EC-TO143 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | ECTO143_RS18280 | Protein ID | WP_001291435.1 |
| Coordinates | 3653356..3653574 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | ECTO143_RS18275 | Protein ID | WP_000344800.1 |
| Coordinates | 3652956..3653330 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO143_RS18265 | 3648045..3649238 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| ECTO143_RS18270 | 3649261..3652410 | + | 3150 | WP_001132478.1 | multidrug efflux RND transporter permease subunit | - |
| ECTO143_RS18275 | 3652956..3653330 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| ECTO143_RS18280 | 3653356..3653574 | + | 219 | WP_001291435.1 | hemolysin expression modulator Hha | Toxin |
| ECTO143_RS18285 | 3653748..3654299 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| ECTO143_RS18290 | 3654415..3654885 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| ECTO143_RS18295 | 3655049..3656599 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| ECTO143_RS18300 | 3656641..3656994 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
| ECTO143_RS18310 | 3657373..3657684 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| ECTO143_RS18315 | 3657715..3658287 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T293073 WP_001291435.1 NZ_LS999560:3653356-3653574 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT293073 WP_000344800.1 NZ_LS999560:3652956-3653330 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |