Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 819755..820589 Replicon chromosome
Accession NZ_LS999560
Organism Escherichia coli isolate EC-TO143

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag ECTO143_RS03990 Protein ID WP_000854690.1
Coordinates 819755..820132 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID -
Locus tag ECTO143_RS03995 Protein ID WP_033551973.1
Coordinates 820221..820589 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO143_RS26960 816149..816304 - 156 WP_000729638.1 hypothetical protein -
ECTO143_RS03965 816736..817669 - 934 Protein_769 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
ECTO143_RS03970 817662..818057 - 396 WP_000208384.1 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein -
ECTO143_RS03975 818126..818971 - 846 WP_001529401.1 DUF4942 domain-containing protein -
ECTO143_RS03980 819056..819253 - 198 WP_000839293.1 DUF957 domain-containing protein -
ECTO143_RS03985 819270..819758 - 489 WP_000761699.1 hypothetical protein -
ECTO143_RS03990 819755..820132 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
ECTO143_RS03995 820221..820589 - 369 WP_033551973.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
ECTO143_RS04000 820639..821283 - 645 WP_000094916.1 hypothetical protein -
ECTO143_RS04005 821302..821523 - 222 WP_000692329.1 DUF987 domain-containing protein -
ECTO143_RS04010 821586..822062 - 477 WP_001186726.1 RadC family protein -
ECTO143_RS04015 822078..822563 - 486 WP_000849565.1 antirestriction protein -
ECTO143_RS04020 822618..823436 - 819 WP_001234620.1 DUF945 domain-containing protein -
ECTO143_RS04030 823537..823770 - 234 WP_000902034.1 DUF905 family protein -
ECTO143_RS04035 823849..824304 - 456 WP_000581502.1 hypothetical protein -
ECTO143_RS04040 824380..825507 - 1128 Protein_783 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - ugd / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat 800289..867514 67225
- flank IS/Tn - - 816149..816304 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T293063 WP_000854690.1 NZ_LS999560:c820132-819755 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13520.50 Da        Isoelectric Point: 5.5045

>AT293063 WP_033551973.1 NZ_LS999560:c820589-820221 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure

References