Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/- |
Location | 477967..478620 | Replicon | chromosome |
Accession | NZ_LS999521 | ||
Organism | Acinetobacter calcoaceticus isolate Acinetobacter calcoaceticus str. 2117 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | AC2117_RS02310 | Protein ID | WP_133971650.1 |
Coordinates | 478231..478620 (+) | Length | 130 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | R8YFS6 |
Locus tag | AC2117_RS02305 | Protein ID | WP_016142980.1 |
Coordinates | 477967..478224 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
AC2117_RS02285 | 473478..474485 | + | 1008 | WP_003653641.1 | DNA-directed RNA polymerase subunit alpha | - |
AC2117_RS02290 | 474504..474881 | + | 378 | WP_042895180.1 | 50S ribosomal protein L17 | - |
AC2117_RS02295 | 475063..476553 | + | 1491 | WP_133971647.1 | NAD(P)/FAD-dependent oxidoreductase | - |
AC2117_RS02300 | 476605..477777 | - | 1173 | WP_133971649.1 | acyl-CoA dehydrogenase family protein | - |
AC2117_RS02305 | 477967..478224 | + | 258 | WP_016142980.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
AC2117_RS02310 | 478231..478620 | + | 390 | WP_133971650.1 | hypothetical protein | Toxin |
AC2117_RS02315 | 479390..480478 | + | 1089 | WP_133971652.1 | hypothetical protein | - |
AC2117_RS02320 | 480561..481136 | + | 576 | WP_133971654.1 | rhombosortase | - |
AC2117_RS02325 | 481315..483510 | + | 2196 | WP_133971656.1 | TRAP transporter large permease subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15441.68 Da Isoelectric Point: 10.0544
>T293058 WP_133971650.1 NZ_LS999521:478231-478620 [Acinetobacter calcoaceticus]
MIKELNFELKYSRFSIIFQLFIGLSLTILLYQLLSPIWWLIALILLSISFLFFLKQSRISQIAYLDQKLWSVAYSSQKII
SRIEITKIIDYQLFIVIYFEGAPIKVAIIWFDQLPLQDWKKLKILQKVY
MIKELNFELKYSRFSIIFQLFIGLSLTILLYQLLSPIWWLIALILLSISFLFFLKQSRISQIAYLDQKLWSVAYSSQKII
SRIEITKIIDYQLFIVIYFEGAPIKVAIIWFDQLPLQDWKKLKILQKVY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|