Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 4775941..4776557 | Replicon | chromosome |
Accession | NZ_LS999206 | ||
Organism | Enterobacter hormaechei isolate EC-TO80 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | ECLTO80_RS23455 | Protein ID | WP_017382676.1 |
Coordinates | 4775941..4776312 (-) | Length | 124 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A6G4MTK3 |
Locus tag | ECLTO80_RS23460 | Protein ID | WP_015569912.1 |
Coordinates | 4776315..4776557 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECLTO80_RS23440 | 4773441..4774343 | + | 903 | WP_014072386.1 | formate dehydrogenase subunit beta | - |
ECLTO80_RS23445 | 4774340..4774975 | + | 636 | WP_015569914.1 | formate dehydrogenase cytochrome b556 subunit | - |
ECLTO80_RS23450 | 4774972..4775901 | + | 930 | WP_003861956.1 | formate dehydrogenase accessory protein FdhE | - |
ECLTO80_RS23455 | 4775941..4776312 | - | 372 | WP_017382676.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ECLTO80_RS23460 | 4776315..4776557 | - | 243 | WP_015569912.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
ECLTO80_RS23465 | 4776756..4777676 | + | 921 | WP_133983330.1 | alpha/beta hydrolase | - |
ECLTO80_RS23470 | 4777685..4778626 | - | 942 | WP_015569910.1 | fatty acid biosynthesis protein FabY | - |
ECLTO80_RS23475 | 4778671..4779108 | - | 438 | WP_015569909.1 | D-tyrosyl-tRNA(Tyr) deacylase | - |
ECLTO80_RS23480 | 4779105..4779986 | - | 882 | WP_003861949.1 | virulence factor BrkB family protein | - |
ECLTO80_RS23485 | 4779980..4780579 | - | 600 | WP_133983332.1 | glucose-1-phosphatase | - |
ECLTO80_RS23490 | 4780698..4781498 | - | 801 | WP_003861944.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 124 a.a. Molecular weight: 13737.88 Da Isoelectric Point: 6.4882
>T293057 WP_017382676.1 NZ_LS999206:c4776312-4775941 [Enterobacter hormaechei]
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
MEHMAVFDTNILIDLFNNRIEAADAIEHTASHRAISLITWMEVMVGARRHGHEAKTAAVMGAFEIIDVSRDIAERSVLLR
EKHGMKLPDAIILATAQSRKCPLISRNTKDFAGIDEVLTPYQV
Download Length: 372 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|