Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3949955..3950612 | Replicon | chromosome |
| Accession | NZ_LS999206 | ||
| Organism | Enterobacter hormaechei isolate EC-TO80 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A179PSF7 |
| Locus tag | ECLTO80_RS19385 | Protein ID | WP_017382887.1 |
| Coordinates | 3949955..3950365 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | G8LDB7 |
| Locus tag | ECLTO80_RS19390 | Protein ID | WP_003863437.1 |
| Coordinates | 3950346..3950612 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECLTO80_RS19365 | 3945953..3947686 | - | 1734 | WP_017382886.1 | single-stranded-DNA-specific exonuclease RecJ | - |
| ECLTO80_RS19370 | 3947692..3948405 | - | 714 | WP_033487627.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| ECLTO80_RS19375 | 3948434..3949330 | - | 897 | WP_003863442.1 | site-specific tyrosine recombinase XerD | - |
| ECLTO80_RS19380 | 3949432..3949953 | + | 522 | WP_015571793.1 | flavodoxin FldB | - |
| ECLTO80_RS19385 | 3949955..3950365 | - | 411 | WP_017382887.1 | protein YgfX | Toxin |
| ECLTO80_RS19390 | 3950346..3950612 | - | 267 | WP_003863437.1 | FAD assembly factor SdhE | Antitoxin |
| ECLTO80_RS19395 | 3950907..3951887 | + | 981 | WP_047636517.1 | tRNA-modifying protein YgfZ | - |
| ECLTO80_RS19400 | 3951999..3952658 | - | 660 | WP_003863433.1 | hemolysin III family protein | - |
| ECLTO80_RS19405 | 3952925..3953656 | + | 732 | WP_015571796.1 | MurR/RpiR family transcriptional regulator | - |
| ECLTO80_RS19410 | 3953773..3955206 | + | 1434 | WP_017382891.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16321.21 Da Isoelectric Point: 11.4775
>T293056 WP_017382887.1 NZ_LS999206:c3950365-3949955 [Enterobacter hormaechei]
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
VVLWQSDLRVSWRSQWMSLLLHGLVAALVLLVPWPLSYTPLWLLLLSFVVFDSVRSQRRINARQGEIKLLMDSRLRWQGK
EWEMMGTPWMLNTGMMLRLRRVEDNRRQHLWLAADSMDPAEWRDLRRLIVQQPTQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A179PSF7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837F8P5 |