Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 2394489..2395228 | Replicon | chromosome |
Accession | NZ_LS999206 | ||
Organism | Enterobacter hormaechei isolate EC-TO80 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A3L9PBP9 |
Locus tag | ECLTO80_RS11855 | Protein ID | WP_003857133.1 |
Coordinates | 2394489..2394974 (-) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A837FCR9 |
Locus tag | ECLTO80_RS11860 | Protein ID | WP_003857131.1 |
Coordinates | 2394962..2395228 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECLTO80_RS11830 | 2390023..2390607 | - | 585 | WP_017382349.1 | GDP-mannose pyrophosphatase nudK | - |
ECLTO80_RS11835 | 2390694..2391452 | + | 759 | WP_045341969.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
ECLTO80_RS11840 | 2391557..2392849 | + | 1293 | WP_133982766.1 | glycoside hydrolase | - |
ECLTO80_RS11845 | 2393020..2393853 | + | 834 | Protein_2273 | hypothetical protein | - |
ECLTO80_RS11850 | 2393869..2394438 | + | 570 | WP_017382346.1 | hypothetical protein | - |
ECLTO80_RS11855 | 2394489..2394974 | - | 486 | WP_003857133.1 | GNAT family N-acetyltransferase | Toxin |
ECLTO80_RS11860 | 2394962..2395228 | - | 267 | WP_003857131.1 | DUF1778 domain-containing protein | Antitoxin |
ECLTO80_RS11865 | 2395292..2396221 | - | 930 | WP_133982768.1 | LysR family transcriptional regulator | - |
ECLTO80_RS11870 | 2396351..2397733 | + | 1383 | WP_062938939.1 | MFS transporter | - |
ECLTO80_RS11875 | 2397756..2398751 | - | 996 | WP_045339807.1 | DUF2891 domain-containing protein | - |
ECLTO80_RS11880 | 2398761..2399747 | - | 987 | WP_017382341.1 | DUF979 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17540.23 Da Isoelectric Point: 9.9658
>T293047 WP_003857133.1 NZ_LS999206:c2394974-2394489 [Enterobacter hormaechei]
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
VGRVTAPEPLSSVHQLAEFVSGEAVLDEWLKQRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTQATGNLRRNM
PDPIPVIILARLAVDVSLRGNGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKAFYIHHGFKASQTQERTLFLRLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A3L9PBP9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A837FCR9 |