Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1150332..1150952 | Replicon | chromosome |
| Accession | NZ_LS999206 | ||
| Organism | Enterobacter hormaechei isolate EC-TO80 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A837FFM2 |
| Locus tag | ECLTO80_RS05640 | Protein ID | WP_015571250.1 |
| Coordinates | 1150332..1150550 (-) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | F5RUW7 |
| Locus tag | ECLTO80_RS05645 | Protein ID | WP_006809850.1 |
| Coordinates | 1150578..1150952 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECLTO80_RS05610 | 1146344..1146604 | + | 261 | WP_015571255.1 | type B 50S ribosomal protein L31 | - |
| ECLTO80_RS05615 | 1146607..1146747 | + | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| ECLTO80_RS05620 | 1146744..1147454 | - | 711 | WP_023303201.1 | GNAT family N-acetyltransferase | - |
| ECLTO80_RS05625 | 1147556..1149016 | + | 1461 | WP_133982424.1 | PLP-dependent aminotransferase family protein | - |
| ECLTO80_RS05630 | 1148988..1149455 | - | 468 | WP_023296041.1 | hypothetical protein | - |
| ECLTO80_RS05635 | 1149572..1150123 | - | 552 | WP_015571251.1 | maltose O-acetyltransferase | - |
| ECLTO80_RS05640 | 1150332..1150550 | - | 219 | WP_015571250.1 | hemolysin expression modulator Hha | Toxin |
| ECLTO80_RS05645 | 1150578..1150952 | - | 375 | WP_006809850.1 | Hha toxicity modulator TomB | Antitoxin |
| ECLTO80_RS05650 | 1151462..1154608 | - | 3147 | WP_015571248.1 | multidrug efflux RND transporter permease subunit | - |
| ECLTO80_RS05655 | 1154631..1155824 | - | 1194 | WP_047365350.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T293044 WP_015571250.1 NZ_LS999206:c1150550-1150332 [Enterobacter hormaechei]
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
MSDKPLTKVDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14497.28 Da Isoelectric Point: 4.8989
>AT293044 WP_006809850.1 NZ_LS999206:c1150952-1150578 [Enterobacter hormaechei]
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
MDEYSPKRHDIAQLKFLCESLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFTNVSRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FFM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A837FGN8 |