Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 684144..684720 | Replicon | chromosome |
| Accession | NZ_LS999206 | ||
| Organism | Enterobacter hormaechei isolate EC-TO80 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A800YKM1 |
| Locus tag | ECLTO80_RS03445 | Protein ID | WP_015572580.1 |
| Coordinates | 684144..684431 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A801DSF4 |
| Locus tag | ECLTO80_RS03450 | Protein ID | WP_017694570.1 |
| Coordinates | 684418..684720 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECLTO80_RS03420 | 679237..679956 | + | 720 | WP_050515874.1 | winged helix-turn-helix domain-containing protein | - |
| ECLTO80_RS03425 | 680106..680576 | + | 471 | WP_033486706.1 | MarR family transcriptional regulator | - |
| ECLTO80_RS03430 | 680573..681640 | + | 1068 | WP_026080654.1 | HlyD family secretion protein | - |
| ECLTO80_RS03435 | 681630..682706 | + | 1077 | WP_015572578.1 | DUF2955 domain-containing protein | - |
| ECLTO80_RS03440 | 682703..683974 | - | 1272 | WP_033486707.1 | DUF445 domain-containing protein | - |
| ECLTO80_RS03445 | 684144..684431 | + | 288 | WP_015572580.1 | BrnT family toxin | Toxin |
| ECLTO80_RS03450 | 684418..684720 | + | 303 | WP_017694570.1 | BrnA antitoxin family protein | Antitoxin |
| ECLTO80_RS03455 | 684749..685387 | - | 639 | WP_033486708.1 | LysE family translocator | - |
| ECLTO80_RS03460 | 685426..686178 | - | 753 | WP_033486709.1 | AraC family transcriptional regulator | - |
| ECLTO80_RS03465 | 686332..687702 | + | 1371 | WP_133982341.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| ECLTO80_RS03470 | 687884..688429 | - | 546 | WP_006810254.1 | porin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11296.81 Da Isoelectric Point: 7.3587
>T293043 WP_015572580.1 NZ_LS999206:684144-684431 [Enterobacter hormaechei]
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
MPIEYEWDSNKAKSNLQKHAIRFEDAVLVFDDPCHLSVQDRYENGEFRWQTIGLVQGVIVILVAHTVRFESGDEIIRIIS
ARKADRKERRRYEHR
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|