Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 762895..763491 | Replicon | chromosome |
| Accession | NZ_LS999205 | ||
| Organism | Pseudomonas protegens CHA0 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2C9EFT8 |
| Locus tag | PPRCHA0_RS03435 | Protein ID | WP_015633982.1 |
| Coordinates | 763189..763491 (-) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A2C9EFR9 |
| Locus tag | PPRCHA0_RS03430 | Protein ID | WP_015633981.1 |
| Coordinates | 762895..763185 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PPRCHA0_RS03410 | 759165..761297 | - | 2133 | WP_015633979.1 | TonB-dependent copper receptor | - |
| PPRCHA0_RS03415 | 761386..761796 | - | 411 | WP_041115676.1 | DUF2946 domain-containing protein | - |
| PPRCHA0_RS03420 | 761852..762331 | - | 480 | WP_026020078.1 | copper chaperone PCu(A)C | - |
| PPRCHA0_RS03425 | 762396..762794 | - | 399 | WP_011059019.1 | DUF2946 domain-containing protein | - |
| PPRCHA0_RS03430 | 762895..763185 | - | 291 | WP_015633981.1 | putative addiction module antidote protein | Antitoxin |
| PPRCHA0_RS03435 | 763189..763491 | - | 303 | WP_015633982.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PPRCHA0_RS03440 | 763675..764403 | - | 729 | WP_011059022.1 | cobalt-precorrin-6A reductase | - |
| PPRCHA0_RS03445 | 764400..765497 | - | 1098 | WP_015633983.1 | cobalt-precorrin-5B (C(1))-methyltransferase | - |
| PPRCHA0_RS03450 | 765591..766805 | - | 1215 | WP_011059024.1 | bifunctional cobalt-precorrin-7 (C(5))-methyltransferase/cobalt-precorrin-6B (C(15))-methyltransferase | - |
| PPRCHA0_RS03455 | 766944..768257 | + | 1314 | WP_015633984.1 | precorrin-3B synthase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11504.34 Da Isoelectric Point: 10.6512
>T293037 WP_015633982.1 NZ_LS999205:c763491-763189 [Pseudomonas protegens CHA0]
MFVFEQTPEFSRWLLNLKDPQGKTRVLARIRAAQLGRFGDCEPVGEGVHEMRIHRGPGYRVYFSRRGKVIYLLLIGGDKA
TQKRDIQRARQLACDLKSEG
MFVFEQTPEFSRWLLNLKDPQGKTRVLARIRAAQLGRFGDCEPVGEGVHEMRIHRGPGYRVYFSRRGKVIYLLLIGGDKA
TQKRDIQRARQLACDLKSEG
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2C9EFT8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2C9EFR9 |