Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 78851..79376 Replicon plasmid 2
Accession NZ_LS998786
Organism Escherichia coli isolate EC-TO75

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag ECTO75_RS23675 Protein ID WP_001159871.1
Coordinates 79071..79376 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag ECTO75_RS23670 Protein ID WP_000813630.1
Coordinates 78851..79069 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO75_RS23640 74061..74747 + 687 Protein_88 IS1 family transposase -
ECTO75_RS23645 75001..76023 - 1023 WP_000361402.1 helicase UvrD -
ECTO75_RS23650 76008..77573 - 1566 WP_001128474.1 AAA family ATPase -
ECTO75_RS23655 77648..78064 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
ECTO75_RS23660 78061..78291 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -
ECTO75_RS23670 78851..79069 + 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
ECTO75_RS23675 79071..79376 + 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
ECTO75_RS23680 79377..80183 + 807 WP_000016970.1 site-specific integrase -
ECTO75_RS23685 80905..81660 + 756 WP_000852146.1 replication initiation protein RepE -
ECTO75_RS23690 82248..83414 + 1167 WP_000772446.1 plasmid-partitioning protein SopA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid sitABCD iucA / iucB / iucC / iucD / iutA 1..103198 103198
- flank IS/Tn - - 74400..74747 347


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T293034 WP_001159871.1 NZ_LS998786:79071-79376 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT293034 WP_000813630.1 NZ_LS998786:78851-79069 [Escherichia coli]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References