Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 77648..78291 | Replicon | plasmid 2 |
Accession | NZ_LS998786 | ||
Organism | Escherichia coli isolate EC-TO75 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | V0UN72 |
Locus tag | ECTO75_RS23655 | Protein ID | WP_001034044.1 |
Coordinates | 77648..78064 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | B1P7N7 |
Locus tag | ECTO75_RS23660 | Protein ID | WP_001261286.1 |
Coordinates | 78061..78291 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO75_RS23640 | 74061..74747 | + | 687 | Protein_88 | IS1 family transposase | - |
ECTO75_RS23645 | 75001..76023 | - | 1023 | WP_000361402.1 | helicase UvrD | - |
ECTO75_RS23650 | 76008..77573 | - | 1566 | WP_001128474.1 | AAA family ATPase | - |
ECTO75_RS23655 | 77648..78064 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
ECTO75_RS23660 | 78061..78291 | - | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
ECTO75_RS23670 | 78851..79069 | + | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
ECTO75_RS23675 | 79071..79376 | + | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
ECTO75_RS23680 | 79377..80183 | + | 807 | WP_000016970.1 | site-specific integrase | - |
ECTO75_RS23685 | 80905..81660 | + | 756 | WP_000852146.1 | replication initiation protein RepE | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | sitABCD | iucA / iucB / iucC / iucD / iutA | 1..103198 | 103198 | |
- | flank | IS/Tn | - | - | 74400..74747 | 347 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T293033 WP_001034044.1 NZ_LS998786:c78064-77648 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CHW1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CKZ6 |