Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PanAT/DUF4065(antitoxin) |
Location | 4351152..4352196 | Replicon | chromosome |
Accession | NZ_LS998785 | ||
Organism | Escherichia coli isolate EC-TO75 |
Toxin (Protein)
Gene name | panT | Uniprot ID | A0A829CP20 |
Locus tag | ECTO75_RS21285 | Protein ID | WP_000019186.1 |
Coordinates | 4351152..4351700 (-) | Length | 183 a.a. |
Antitoxin (Protein)
Gene name | panA | Uniprot ID | A0A839B6W4 |
Locus tag | ECTO75_RS21290 | Protein ID | WP_000287252.1 |
Coordinates | 4351723..4352196 (-) | Length | 158 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO75_RS21240 | 4346364..4346915 | - | 552 | WP_000515860.1 | hypothetical protein | - |
ECTO75_RS21245 | 4346959..4347159 | - | 201 | WP_000649477.1 | helix-turn-helix domain-containing protein | - |
ECTO75_RS21250 | 4347250..4347924 | + | 675 | WP_000859462.1 | LexA family transcriptional repressor | - |
ECTO75_RS21265 | 4348591..4348953 | + | 363 | WP_000135682.1 | hypothetical protein | - |
ECTO75_RS21270 | 4349019..4349843 | + | 825 | WP_001753751.1 | DUF2303 family protein | - |
ECTO75_RS21275 | 4350060..4350812 | + | 753 | WP_001701368.1 | hypothetical protein | - |
ECTO75_RS21280 | 4350849..4351118 | + | 270 | WP_001093912.1 | pyocin activator PrtN family protein | - |
ECTO75_RS21285 | 4351152..4351700 | - | 549 | WP_000019186.1 | hypothetical protein | Toxin |
ECTO75_RS21290 | 4351723..4352196 | - | 474 | WP_000287252.1 | SocA family protein | Antitoxin |
ECTO75_RS21295 | 4352483..4352605 | - | 123 | WP_001300034.1 | hypothetical protein | - |
ECTO75_RS21300 | 4352968..4353984 | - | 1017 | WP_000912595.1 | DUF2713 family protein | - |
ECTO75_RS21310 | 4354302..4354817 | + | 516 | WP_001295691.1 | zinc uptake transcriptional repressor Zur | - |
ECTO75_RS21315 | 4354859..4355068 | - | 210 | WP_001030593.1 | CsbD family protein | - |
ECTO75_RS21320 | 4355184..4356509 | - | 1326 | WP_001301116.1 | MATE family efflux transporter DinF | - |
ECTO75_RS21325 | 4356582..4357190 | - | 609 | WP_000646078.1 | transcriptional repressor LexA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4328364..4357190 | 28826 | |
- | inside | Prophage | - | espX5 / espX4 / espX4 | 4310223..4367521 | 57298 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 183 a.a. Molecular weight: 20026.39 Da Isoelectric Point: 4.4481
>T293024 WP_000019186.1 NZ_LS998785:c4351700-4351152 [Escherichia coli]
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
MSHNSDIYKLIGAAAGVENGRSEASLNSTDSQEQAFESAFEPSNHERDDDSSSENKAILEEEEFGSNTGALHEFMQQNRM
DSLQAQLDMLKSQVRDKIADATGKEIDNELRTKMASFTVWFMSCWCLFVVAMFTSFLIAHEGKAPVEAIVALLGTSTISI
VGLVGFVVSGLFKSRKDSDKEK
Download Length: 549 bp
Antitoxin
Download Length: 158 a.a. Molecular weight: 17298.80 Da Isoelectric Point: 8.4143
>AT293024 WP_000287252.1 NZ_LS998785:c4352196-4351723 [Escherichia coli]
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
MYSPVQIANKFITLGNQHHNPLTHMQLQKLTYIAHGYYLALTGKPLLNECVSAWKYGPVIPGMYDAFKDYGNKPVTNVAV
APFGGIVTMDPQAESIIGAVYKFYGSKNGIELSTLTHMPGTPWSQAYNGIGSSIISNDAIKAYYHDLLNNRQQCQGL
Download Length: 474 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CP20 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A839B6W4 |