Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 3017384..3018426 | Replicon | chromosome |
Accession | NZ_LS998783 | ||
Organism | Pseudomonas aeruginosa isolate |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PA5486_RS14905 | Protein ID | WP_003153636.1 |
Coordinates | 3017851..3018426 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PA5486_RS14900 | Protein ID | WP_003050245.1 |
Coordinates | 3017384..3017854 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PA5486_RS14865 | 3012776..3014194 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
PA5486_RS14870 | 3014184..3015095 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
PA5486_RS14875 | 3015092..3015784 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
PA5486_RS14880 | 3015781..3016179 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
PA5486_RS14885 | 3016191..3016550 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PA5486_RS14890 | 3016567..3016800 | - | 234 | WP_023101201.1 | TIGR03758 family integrating conjugative element protein | - |
PA5486_RS14895 | 3016797..3017180 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PA5486_RS14900 | 3017384..3017854 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PA5486_RS14905 | 3017851..3018426 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PA5486_RS14910 | 3018444..3019358 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
PA5486_RS14915 | 3019355..3019825 | + | 471 | WP_003090160.1 | hypothetical protein | - |
PA5486_RS14920 | 3019822..3020322 | + | 501 | WP_003090159.1 | hypothetical protein | - |
PA5486_RS14925 | 3020322..3021224 | + | 903 | WP_003090158.1 | nucleotidyltransferase domain-containing protein | - |
PA5486_RS14930 | 3021263..3021988 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T293004 WP_003153636.1 NZ_LS998783:3017851-3018426 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT293004 WP_003050245.1 NZ_LS998783:3017384-3017854 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|