Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-YafN |
| Location | 2719503..2720019 | Replicon | chromosome |
| Accession | NZ_LS998783 | ||
| Organism | Pseudomonas aeruginosa isolate | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A3R8UIH5 |
| Locus tag | PA5486_RS13545 | Protein ID | WP_025297453.1 |
| Coordinates | 2719738..2720019 (+) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A3R8UIM7 |
| Locus tag | PA5486_RS13540 | Protein ID | WP_025297454.1 |
| Coordinates | 2719503..2719748 (+) | Length | 82 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PA5486_RS13520 | 2714625..2714954 | - | 330 | WP_031692728.1 | hypothetical protein | - |
| PA5486_RS13525 | 2715302..2715970 | + | 669 | WP_071534660.1 | hypothetical protein | - |
| PA5486_RS13530 | 2715967..2717073 | + | 1107 | WP_025297456.1 | XRE family transcriptional regulator | - |
| PA5486_RS13535 | 2717204..2719345 | + | 2142 | WP_025297455.1 | hypothetical protein | - |
| PA5486_RS13540 | 2719503..2719748 | + | 246 | WP_025297454.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| PA5486_RS13545 | 2719738..2720019 | + | 282 | WP_025297453.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PA5486_RS13550 | 2720425..2721006 | - | 582 | WP_033895412.1 | plasmid pRiA4b ORF-3 family protein | - |
| PA5486_RS13555 | 2721020..2721895 | - | 876 | WP_033895413.1 | WYL domain-containing protein | - |
| PA5486_RS13560 | 2722030..2723604 | + | 1575 | WP_025297452.1 | DNA recombination protein RmuC | - |
| PA5486_RS13565 | 2723628..2724276 | + | 649 | Protein_2612 | peptidase M15 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2705982..2773750 | 67768 | |
| - | inside | Genomic island | - | - | 2693900..2774179 | 80279 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10824.61 Da Isoelectric Point: 10.6249
>T293003 WP_025297453.1 NZ_LS998783:2719738-2720019 [Pseudomonas aeruginosa]
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
MTYELEFLPSALKEWQKLGHTVREQIKKKLRERLDNPKVQADALRDMPGHYKIKLRASGYRLVYRVEDERVVVVVVAVGK
RERGAAYQSAKGR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3R8UIM7 |