Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 692046..692660 | Replicon | chromosome |
| Accession | NZ_LS998783 | ||
| Organism | Pseudomonas aeruginosa isolate | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A6VBH9 |
| Locus tag | PA5486_RS03445 | Protein ID | WP_071534354.1 |
| Coordinates | 692046..692228 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A140SDX7 |
| Locus tag | PA5486_RS03450 | Protein ID | WP_012077229.1 |
| Coordinates | 692256..692660 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PA5486_RS35270 | 689017..689160 | + | 144 | WP_153274318.1 | hypothetical protein | - |
| PA5486_RS03430 | 689487..689822 | - | 336 | Protein_656 | NERD domain-containing protein | - |
| PA5486_RS03435 | 689915..691036 | - | 1122 | WP_015649718.1 | Fic family protein | - |
| PA5486_RS03440 | 691295..691431 | - | 137 | Protein_658 | integrase | - |
| PA5486_RS03445 | 692046..692228 | + | 183 | WP_071534354.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| PA5486_RS03450 | 692256..692660 | + | 405 | WP_012077229.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| PA5486_RS03455 | 692703..693674 | - | 972 | WP_012077228.1 | hypothetical protein | - |
| PA5486_RS03460 | 693659..694357 | - | 699 | WP_033896049.1 | hypothetical protein | - |
| PA5486_RS03465 | 694357..694896 | - | 540 | WP_012074127.1 | hypothetical protein | - |
| PA5486_RS03470 | 694893..695813 | - | 921 | WP_012074128.1 | hypothetical protein | - |
| PA5486_RS03475 | 695810..696520 | - | 711 | WP_012074129.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 689915..745130 | 55215 | |
| - | inside | Prophage | - | - | 689915..744287 | 54372 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6702.74 Da Isoelectric Point: 10.4826
>T292999 WP_071534354.1 NZ_LS998783:692046-692228 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14670.54 Da Isoelectric Point: 4.4315
>AT292999 WP_012077229.1 NZ_LS998783:692256-692660 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6VBH9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140SDX7 |