Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
| Location | 144858..145363 | Replicon | chromosome |
| Accession | NZ_LS998783 | ||
| Organism | Pseudomonas aeruginosa isolate | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | V6A7K8 |
| Locus tag | PA5486_RS00715 | Protein ID | WP_003083773.1 |
| Coordinates | 144858..145139 (-) | Length | 94 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A1C7BDS9 |
| Locus tag | PA5486_RS00720 | Protein ID | WP_003083775.1 |
| Coordinates | 145136..145363 (-) | Length | 76 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PA5486_RS00690 | 140109..141458 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
| PA5486_RS00695 | 141507..142193 | + | 687 | WP_003083762.1 | FadR family transcriptional regulator | - |
| PA5486_RS00700 | 142294..143028 | + | 735 | WP_004346926.1 | GntR family transcriptional regulator | - |
| PA5486_RS00705 | 143232..143618 | + | 387 | WP_014602345.1 | aegerolysin family protein | - |
| PA5486_RS00710 | 143650..144558 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
| PA5486_RS00715 | 144858..145139 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
| PA5486_RS00720 | 145136..145363 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| PA5486_RS00725 | 145539..146159 | - | 621 | WP_003101226.1 | hypothetical protein | - |
| PA5486_RS00730 | 146260..146760 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
| PA5486_RS00735 | 146833..147174 | + | 342 | WP_003101229.1 | alkylphosphonate utilization protein | - |
| PA5486_RS00740 | 147256..148683 | - | 1428 | WP_003083784.1 | GABA permease | - |
| PA5486_RS00745 | 148852..150345 | - | 1494 | WP_003083788.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T292998 WP_003083773.1 NZ_LS998783:c145139-144858 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|