Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /BrnT(toxin)
Location 614755..615253 Replicon chromosome
Accession NZ_LS997868
Organism Vibrio cholerae strain NCTC 30

Toxin (Protein)


Gene name - Uniprot ID Q9KMK7
Locus tag D5R51_RS17125 Protein ID WP_000589156.1
Coordinates 614755..615021 (+) Length 89 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID Q9KMK6
Locus tag D5R51_RS17130 Protein ID WP_000643598.1
Coordinates 615008..615253 (+) Length 82 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
D5R51_RS17070 609969..610271 + 303 WP_119091963.1 hypothetical protein -
D5R51_RS17075 610394..610684 - 291 WP_076008724.1 type II toxin-antitoxin system RelE/ParE family toxin -
D5R51_RS17080 610674..610922 - 249 WP_000213183.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
D5R51_RS17090 611201..611457 + 257 Protein_619 DUF645 family protein -
D5R51_RS17100 611652..612146 + 495 WP_119091965.1 GNAT family N-acetyltransferase -
D5R51_RS17105 612255..613295 + 1041 WP_057645437.1 IS481 family transposase -
D5R51_RS17110 613355..613915 + 561 Protein_622 hypothetical protein -
D5R51_RS17115 613939..614049 + 111 WP_071936869.1 DUF3265 domain-containing protein -
D5R51_RS17120 614124..614435 + 312 WP_162892124.1 DUF3709 domain-containing protein -
D5R51_RS17125 614755..615021 + 267 WP_000589156.1 BrnT family toxin Toxin
D5R51_RS17130 615008..615253 + 246 WP_000643598.1 hypothetical protein Antitoxin
D5R51_RS17140 615392..615862 - 471 WP_119091966.1 RES family NAD+ phosphorylase -
D5R51_RS17145 615862..616314 - 453 WP_119091967.1 DUF2384 domain-containing protein -
D5R51_RS17150 616421..617212 - 792 Protein_629 IS110 family transposase -
D5R51_RS17155 617530..618516 - 987 WP_001170903.1 sulfate ABC transporter substrate-binding protein -
D5R51_RS17160 619182..619409 + 228 WP_119091968.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron blaCARB-7 - 497585..615862 118277
- inside Prophage - - 577112..635317 58205
- inside IScluster/Tn - - 607167..616981 9814


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Ribonuclease toxin, BrnT, of type II toxin-antitoxin system

(6-81)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 89 a.a.        Molecular weight: 10092.34 Da        Isoelectric Point: 7.3171

>T292997 WP_000589156.1 NZ_LS997868:614755-615021 [Vibrio cholerae]
MIKFEFDENKSRSNLEKHGIDFHTAQGLWNDSDLIEIPANTSDEPRYLVVGLLNGKHWSGVITYRGTNIRIISVRRSRKA
EVSLYESA

Download         Length: 267 bp

Antitoxin


Download         Length: 82 a.a.        Molecular weight: 9478.77 Da        Isoelectric Point: 6.4832

>AT292997 WP_000643598.1 NZ_LS997868:615008-615253 [Vibrio cholerae]
MKAHEFDAKFESDDDDIVMDLDLSQAKRPMHKQKRVNVDFPAWMLESLDREASRIGVTRQSIIKIWLAERLESVSHHSSV
R

Download         Length: 246 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A271VMP7

Antitoxin

Source ID Structure
AlphaFold DB A0A271VME2

References