Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 610394..610922 Replicon chromosome
Accession NZ_LS997868
Organism Vibrio cholerae strain NCTC 30

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag D5R51_RS17075 Protein ID WP_076008724.1
Coordinates 610394..610684 (-) Length 97 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID H9L4T4
Locus tag D5R51_RS17080 Protein ID WP_000213183.1
Coordinates 610674..610922 (-) Length 83 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
D5R51_RS17025 605723..605893 + 171 WP_113600562.1 DUF3709 domain-containing protein -
D5R51_RS17030 606226..606642 + 417 WP_119091961.1 DUF1311 domain-containing protein -
D5R51_RS17040 606809..607111 + 303 Protein_610 isochorismatase family protein -
D5R51_RS17045 607167..608208 - 1042 Protein_611 IS481 family transposase -
D5R51_RS17050 608317..608562 + 246 Protein_612 isochorismatase family protein -
D5R51_RS17055 608736..609149 + 414 WP_119091962.1 GNAT family N-acetyltransferase -
D5R51_RS17060 609260..609444 + 185 Protein_614 DUF3709 domain-containing protein -
D5R51_RS17065 609441..609674 + 234 WP_033930090.1 DUF3709 domain-containing protein -
D5R51_RS17070 609969..610271 + 303 WP_119091963.1 hypothetical protein -
D5R51_RS17075 610394..610684 - 291 WP_076008724.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
D5R51_RS17080 610674..610922 - 249 WP_000213183.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
D5R51_RS17090 611201..611457 + 257 Protein_619 DUF645 family protein -
D5R51_RS17100 611652..612146 + 495 WP_119091965.1 GNAT family N-acetyltransferase -
D5R51_RS17105 612255..613295 + 1041 WP_057645437.1 IS481 family transposase -
D5R51_RS17110 613355..613915 + 561 Protein_622 hypothetical protein -
D5R51_RS17115 613939..614049 + 111 WP_071936869.1 DUF3265 domain-containing protein -
D5R51_RS17120 614124..614435 + 312 WP_162892124.1 DUF3709 domain-containing protein -
D5R51_RS17125 614755..615021 + 267 WP_000589156.1 BrnT family toxin -
D5R51_RS17130 615008..615253 + 246 WP_000643598.1 hypothetical protein -
D5R51_RS17140 615392..615862 - 471 WP_119091966.1 RES family NAD+ phosphorylase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron blaCARB-7 - 497585..615862 118277
- inside Prophage - - 577112..635317 58205
- inside IScluster/Tn - - 607167..616981 9814


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 97 a.a.        Molecular weight: 11233.16 Da        Isoelectric Point: 10.3910

>T292996 WP_076008724.1 NZ_LS997868:c610684-610394 [Vibrio cholerae]
MTYKLEFKKSALKEWKKLAVPLQQQFKNKLIERLENPHVPSAKLSGAENIYKIKLRQSGYRLVYQVENDIIVVTVLAVGK
RERSEVYTKALQRLDD

Download         Length: 291 bp

Antitoxin


Download         Length: 83 a.a.        Molecular weight: 8937.28 Da        Isoelectric Point: 4.1079

>AT292996 WP_000213183.1 NZ_LS997868:c610922-610674 [Vibrio cholerae]
MTTRILADVAASITEFKANPMKVATSAFGAPVAVLNRNEPAFYCVPASTYEIMMDKLEDLELLAIAKERLSEDSVSVNID
DL

Download         Length: 249 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A366A3W8

References