Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 597488..598016 Replicon chromosome
Accession NZ_LS997868
Organism Vibrio cholerae strain NCTC 30

Toxin (Protein)


Gene name relE Uniprot ID A0A0X1KZS6
Locus tag D5R51_RS16920 Protein ID WP_000221354.1
Coordinates 597729..598016 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID -
Locus tag D5R51_RS16915 Protein ID WP_001250180.1
Coordinates 597488..597739 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
D5R51_RS16870 593034..593573 + 540 WP_084997774.1 hydrolase -
D5R51_RS16875 593771..594001 - 231 WP_000838533.1 PAS factor family protein -
D5R51_RS16885 594381..594560 + 180 WP_119092153.1 DUF645 family protein -
D5R51_RS16890 594711..595082 + 372 WP_185835254.1 DUF4144 domain-containing protein -
D5R51_RS16895 595248..596615 - 1368 WP_119091958.1 Fic family protein -
D5R51_RS16900 596717..596857 + 141 WP_083806583.1 DUF3265 domain-containing protein -
D5R51_RS16910 597045..597223 + 179 Protein_591 DUF645 family protein -
D5R51_RS16915 597488..597739 + 252 WP_001250180.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
D5R51_RS16920 597729..598016 + 288 WP_000221354.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
D5R51_RS16930 598176..598805 + 630 WP_114829152.1 hypothetical protein -
D5R51_RS16935 599019..599309 + 291 WP_119092154.1 YkgJ family cysteine cluster protein -
D5R51_RS16940 599541..599930 + 390 WP_162892123.1 VOC family protein -
D5R51_RS16945 600126..600449 + 324 WP_114780077.1 DUF3709 domain-containing protein -
D5R51_RS16950 600774..601052 + 279 Protein_598 flavodoxin family protein -
D5R51_RS16955 601109..601204 + 96 WP_119091959.1 acetyltransferase -
D5R51_RS16960 601236..601649 + 414 WP_002029857.1 VOC family protein -
D5R51_RS16970 601854..602567 + 714 WP_185835382.1 Fic family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron blaCARB-7 - 497585..615862 118277
- inside Prophage - - 577112..635317 58205


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(11-70)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10991.96 Da        Isoelectric Point: 10.4934

>T292994 WP_000221354.1 NZ_LS997868:597729-598016 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSAKLRGYDAVYKIKLRTAGYRLAYEVIDDEIVVYVLAVGK
RDKDAVYKKLASRFG

Download         Length: 288 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9152.29 Da        Isoelectric Point: 4.0197

>AT292994 WP_001250180.1 NZ_LS997868:597488-597739 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLIDMLDDYELSQIVDSRRADLSQAVEVNI
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0X1KZS6

Antitoxin

Source ID Structure

References