Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-YafN
Location 588914..589479 Replicon chromosome
Accession NZ_LS997868
Organism Vibrio cholerae strain NCTC 30

Toxin (Protein)


Gene name relE Uniprot ID -
Locus tag D5R51_RS16815 Protein ID WP_119091951.1
Coordinates 589192..589479 (+) Length 96 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID D0IIK3
Locus tag D5R51_RS16810 Protein ID WP_000086649.1
Coordinates 588914..589195 (+) Length 94 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
D5R51_RS16765 584241..585137 + 897 WP_097353652.1 helix-turn-helix transcriptional regulator -
D5R51_RS16770 585263..586303 + 1041 WP_119091947.1 IS481 family transposase -
D5R51_RS16775 586578..586949 + 372 WP_001008379.1 hypothetical protein -
D5R51_RS16785 587079..587396 - 318 WP_000077274.1 CcdB family protein -
D5R51_RS16790 587396..587641 - 246 WP_119091949.1 type II toxin-antitoxin system CcdA family antitoxin -
D5R51_RS16795 587839..588180 + 342 WP_119091923.1 hypothetical protein -
D5R51_RS16800 588191..588286 + 96 Protein_574 DUF3265 domain-containing protein -
D5R51_RS16805 588472..588654 + 183 WP_119091950.1 DUF645 family protein -
D5R51_RS16810 588914..589195 + 282 WP_000086649.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
D5R51_RS16815 589192..589479 + 288 WP_119091951.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
D5R51_RS16820 589581..589765 + 185 Protein_578 DUF3709 domain-containing protein -
D5R51_RS16825 589762..589995 + 234 WP_033930090.1 DUF3709 domain-containing protein -
D5R51_RS19010 590424..590628 + 205 Protein_580 DUF645 family protein -
D5R51_RS16845 590882..591169 + 288 WP_001162670.1 type II toxin-antitoxin system RelE/ParE family toxin -
D5R51_RS16850 591180..591497 + 318 WP_119091955.1 HigA family addiction module antidote protein -
D5R51_RS16855 591650..592273 + 624 WP_000247072.1 DUF1349 domain-containing protein -
D5R51_RS16860 592435..592887 + 453 WP_044128081.1 GNAT family N-acetyltransferase -
D5R51_RS16870 593034..593573 + 540 WP_084997774.1 hydrolase -
D5R51_RS16875 593771..594001 - 231 WP_000838533.1 PAS factor family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron blaCARB-7 - 497585..615862 118277
- inside Prophage - - 577112..635317 58205
- flank IS/Tn - - 585263..586303 1040


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-88)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(9-74)


Sequences

Toxin        


Download         Length: 96 a.a.        Molecular weight: 10939.71 Da        Isoelectric Point: 6.4780

>T292992 WP_119091951.1 NZ_LS997868:589192-589479 [Vibrio cholerae]
MKVVWSPLALQKLGDAAEFIALDNPSAAEKWVNEVFDKTELLGSMPEMGRMVPEMPHTNYREIIFGHYRIIYSLSHEIRV
LTVRNCRQLLTEHGV

Download         Length: 288 bp

Antitoxin


Download         Length: 94 a.a.        Molecular weight: 10361.93 Da        Isoelectric Point: 5.1548

>AT292992 WP_000086649.1 NZ_LS997868:588914-589195 [Vibrio cholerae]
MSRIHLDQDIQPLSEFRAGVASFIKQINETRRPLVITQRGKGVAVVLDVAEYEAMQEKIELLEEMRTAEAQLAAGLGISN
EDARSQVLGRIIK

Download         Length: 282 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A0K9UIW4

References