Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/ParE-RHH |
| Location | 580456..580994 | Replicon | chromosome |
| Accession | NZ_LS997868 | ||
| Organism | Vibrio cholerae strain NCTC 30 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q9KMJ0 |
| Locus tag | D5R51_RS16715 | Protein ID | WP_000802136.1 |
| Coordinates | 580456..580755 (-) | Length | 100 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | A0A271VK51 |
| Locus tag | D5R51_RS16720 | Protein ID | WP_001107720.1 |
| Coordinates | 580752..580994 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D5R51_RS16675 | 575511..575729 | + | 219 | WP_162892121.1 | DUF3709 domain-containing protein | - |
| D5R51_RS16680 | 576012..576395 | + | 384 | WP_001081300.1 | hypothetical protein | - |
| D5R51_RS16685 | 576539..577036 | + | 498 | WP_000259904.1 | GNAT family N-acetyltransferase | - |
| D5R51_RS16690 | 577112..578292 | + | 1181 | WP_119091239.1 | IS3 family transposase | - |
| D5R51_RS16705 | 579879..580331 | + | 453 | WP_119091943.1 | hypothetical protein | - |
| D5R51_RS16715 | 580456..580755 | - | 300 | WP_000802136.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| D5R51_RS16720 | 580752..580994 | - | 243 | WP_001107720.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
| D5R51_RS16730 | 581364..581684 | + | 321 | WP_119091944.1 | DUF645 family protein | - |
| D5R51_RS16745 | 582101..582766 | + | 666 | WP_119091946.1 | site-specific DNA-methyltransferase | - |
| D5R51_RS16750 | 582925..583506 | + | 582 | WP_114813644.1 | hypothetical protein | - |
| D5R51_RS16755 | 583503..583613 | + | 111 | WP_119092152.1 | DUF3265 domain-containing protein | - |
| D5R51_RS16760 | 583799..583981 | + | 183 | WP_000923340.1 | DUF645 family protein | - |
| D5R51_RS16765 | 584241..585137 | + | 897 | WP_097353652.1 | helix-turn-helix transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integron | blaCARB-7 | - | 497585..615862 | 118277 | |
| - | inside | Prophage | - | - | 577112..635317 | 58205 | |
| - | flank | IS/Tn | - | - | 585263..586303 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11589.29 Da Isoelectric Point: 9.9232
>T292991 WP_000802136.1 NZ_LS997868:c580755-580456 [Vibrio cholerae]
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
MKPFNLTVAAKADLRDIALFTQRRWGKEQRNVYLKQFDDSFWLLAENPDIGKSCDEIREGYRKFPQGSHVIFYQQTGSQQ
IRVIRILHKSMDVNPIFGA
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|