Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relB-yefM/YoeB-RelB
Location 574069..574579 Replicon chromosome
Accession NZ_LS997868
Organism Vibrio cholerae strain NCTC 30

Toxin (Protein)


Gene name relB Uniprot ID A0A7Z7VK37
Locus tag D5R51_RS16660 Protein ID WP_000098715.1
Coordinates 574316..574579 (+) Length 88 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID A0A7Y3QZ95
Locus tag D5R51_RS16655 Protein ID WP_001223794.1
Coordinates 574069..574323 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
D5R51_RS16600 569238..569475 + 238 Protein_541 DUF645 family protein -
D5R51_RS16605 569689..570693 + 1005 WP_000964925.1 LD-carboxypeptidase -
D5R51_RS16610 570894..571136 + 243 WP_000107462.1 hypothetical protein -
D5R51_RS16615 571251..571412 + 162 Protein_544 hypothetical protein -
D5R51_RS16620 571448..571666 + 219 WP_162892119.1 DUF3709 domain-containing protein -
D5R51_RS16625 572000..572251 + 252 WP_001250181.1 type II toxin-antitoxin system Phd/YefM family antitoxin -
D5R51_RS16630 572241..572528 + 288 WP_000221356.1 type II toxin-antitoxin system RelE/ParE family toxin -
D5R51_RS16635 572565..572654 + 90 WP_119091940.1 hypothetical protein -
D5R51_RS16640 572828..573009 + 182 Protein_549 DUF645 family protein -
D5R51_RS16645 573041..573616 + 576 WP_162892120.1 DUF2971 domain-containing protein -
D5R51_RS16650 573840..573968 + 129 WP_080388421.1 DUF3265 domain-containing protein -
D5R51_RS16655 574069..574323 + 255 WP_001223794.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
D5R51_RS16660 574316..574579 + 264 WP_000098715.1 Txe/YoeB family addiction module toxin Toxin
D5R51_RS16670 574832..575092 + 261 WP_162892167.1 DUF3709 domain-containing protein -
D5R51_RS16675 575511..575729 + 219 WP_162892121.1 DUF3709 domain-containing protein -
D5R51_RS16680 576012..576395 + 384 WP_001081300.1 hypothetical protein -
D5R51_RS16685 576539..577036 + 498 WP_000259904.1 GNAT family N-acetyltransferase -
D5R51_RS16690 577112..578292 + 1181 WP_119091239.1 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron blaCARB-7 - 497585..615862 118277
- inside Prophage - - 577112..635317 58205


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(8-87)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 88 a.a.        Molecular weight: 10415.75 Da        Isoelectric Point: 7.9816

>T292990 WP_000098715.1 NZ_LS997868:574316-574579 [Vibrio cholerae]
MSSRLLSWTDESWDDYLYWQTQDKKTLKRINKIINDVKRSPFEGIGKPEPLKENLSGFWSRRIDDTNRLVYAVDDNAITI
ISCRYHY

Download         Length: 264 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9437.64 Da        Isoelectric Point: 5.0481

>AT292990 WP_001223794.1 NZ_LS997868:574069-574323 [Vibrio cholerae]
MRIVSFTEARNSLKAVLDAVVNDADTTVITRRDSEDAVVMSLDYYNSLMETVHLLRSPANAEHLNRSIAQFKAGKVTQRD
LIDE

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7Z7VK37

Antitoxin

Source ID Structure
AlphaFold DB A0A7Y3QZ95

References