Detailed information of TA system TA292989

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): relBE/ParE-YafN
• Location: 572000..572528
• Replicon: chromosome
• Accession: NZ_LS997868
• Organism: Vibrio cholerae strain NCTC 30

Toxin (Protein)

• Gene name: relE
• Uniprot ID: W9UY41
• Locus tag: D5R51_RS16630
• Protein ID: WP_000221356.1
• Coordinates: 572241..572528 (+)
• Length: 96 a.a.

Antitoxin (Protein)

• Gene name: relB
• Uniprot ID: W9V7T8
• Locus tag: D5R51_RS16625
• Protein ID: WP_001250181.1
• Coordinates: 572000..572251 (+)
• Length: 84 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
D5R51_RS16565	567188..567430	-	243	WP_000557291.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
D5R51_RS16570	567665..568465	+	801	WP_114763308.1	nucleotide-binding protein	-
D5R51_RS16575	568456..568572	+	117	WP_114763309.1	DUF3265 domain-containing protein	-
D5R51_RS16585	568762..568883	+	122	Protein_539	DUF645 family protein	-
D5R51_RS16590	568902..568940	+	39	WP_108244118.1	hypothetical protein	-
D5R51_RS16600	569238..569475	+	238	Protein_541	DUF645 family protein	-
D5R51_RS16605	569689..570693	+	1005	WP_000964925.1	LD-carboxypeptidase	-
D5R51_RS16610	570894..571136	+	243	WP_000107462.1	hypothetical protein	-
D5R51_RS16615	571251..571412	+	162	Protein_544	hypothetical protein	-
D5R51_RS16620	571448..571666	+	219	WP_162892119.1	DUF3709 domain-containing protein	-
D5R51_RS16625	572000..572251	+	252	WP_001250181.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
D5R51_RS16630	572241..572528	+	288	WP_000221356.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
D5R51_RS16635	572565..572654	+	90	WP_119091940.1	hypothetical protein	-
D5R51_RS16640	572828..573009	+	182	Protein_549	DUF645 family protein	-
D5R51_RS16645	573041..573616	+	576	WP_162892120.1	DUF2971 domain-containing protein	-
D5R51_RS16650	573840..573968	+	129	WP_080388421.1	DUF3265 domain-containing protein	-
D5R51_RS16655	574069..574323	+	255	WP_001223794.1	type II toxin-antitoxin system prevent-host-death family antitoxin	-
D5R51_RS16660	574316..574579	+	264	WP_000098715.1	Txe/YoeB family addiction module toxin	-
D5R51_RS16670	574832..575092	+	261	WP_162892167.1	DUF3709 domain-containing protein	-
D5R51_RS16675	575511..575729	+	219	WP_162892121.1	DUF3709 domain-containing protein	-
D5R51_RS16680	576012..576395	+	384	WP_001081300.1	hypothetical protein	-
D5R51_RS16685	576539..577036	+	498	WP_000259904.1	GNAT family N-acetyltransferase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integron	blaCARB-7	-	497585..615862	118277
	-	inside	Prophage	-	-	577112..635317	58205

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (4-81)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (11-62)

Sequences

Toxin

Protein

• Length: 96 a.a.
• Molecular weight: 11054.97 Da
• Isoelectric Point: 10.5827

>T292989 WP_000221356.1 NZ_LS997868:572241-572528 [Vibrio cholerae]
MTYKLKFLPAAQKEWSKLAPTIQSQFKKKLKERLENPHVPSSKLRGYDSVYKIKLRTSGYRLAYEVIDNEVVVYVLAVGK
RDKDAVYKKLASRFS

Nucleotide

• Length: 288 bp

Antitoxin

Protein

• Length: 84 a.a.
• Molecular weight: 9170.32 Da
• Isoelectric Point: 4.0197

>AT292989 WP_001250181.1 NZ_LS997868:572000-572251 [Vibrio cholerae]
MRQVLANCSASISELKKNPTALLNEADGSAIAILNHNKPAAYLVPAETYEYLMDMLDDYELSQIVDSRRGDLSQAVEINI
DDL

Nucleotide

• Length: 252 bp

Structures

Toxin

• AlphaFold DB: W9UY41

Antitoxin

• AlphaFold DB: W9V7T8