Detailed information of TA system TA292988

Bioinformatically predicted

Overview

TA module

• Type: II
• Classification (family/domain): parDE/ParE-Phd
• Location: 566852..567430
• Replicon: chromosome
• Accession: NZ_LS997868
• Organism: Vibrio cholerae strain NCTC 30

Toxin (Protein)

• Gene name: parE
• Uniprot ID: -
• Locus tag: D5R51_RS16560
• Protein ID: WP_001180246.1
• Coordinates: 566852..567169 (-)
• Length: 106 a.a.

Antitoxin (Protein)

• Gene name: parD
• Uniprot ID: A0A366AI09
• Locus tag: D5R51_RS16565
• Protein ID: WP_000557291.1
• Coordinates: 567188..567430 (-)
• Length: 81 a.a.

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
D5R51_RS16510	561876..562133	+	258	WP_000861987.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-
D5R51_RS16515	562121..562423	+	303	WP_000229322.1	type II toxin-antitoxin system RelE/ParE family toxin	-
D5R51_RS16520	562737..562919	+	183	WP_119091920.1	DUF645 family protein	-
D5R51_RS16525	563137..563493	+	357	WP_002033264.1	hypothetical protein	-
D5R51_RS16530	563806..563976	+	171	Protein_532	DUF645 family protein	-
D5R51_RS16535	564179..564643	+	465	WP_119091937.1	ASCH domain-containing protein	-
D5R51_RS16550	565402..566268	+	867	WP_113612726.1	PSE family carbenicillin-hydrolyzing class A beta-lactamase	-
D5R51_RS16560	566852..567169	-	318	WP_001180246.1	type II toxin-antitoxin system RelE/ParE family toxin	Toxin
D5R51_RS16565	567188..567430	-	243	WP_000557291.1	type II toxin-antitoxin system Phd/YefM family antitoxin	Antitoxin
D5R51_RS16570	567665..568465	+	801	WP_114763308.1	nucleotide-binding protein	-
D5R51_RS16575	568456..568572	+	117	WP_114763309.1	DUF3265 domain-containing protein	-
D5R51_RS16585	568762..568883	+	122	Protein_539	DUF645 family protein	-
D5R51_RS16590	568902..568940	+	39	WP_108244118.1	hypothetical protein	-
D5R51_RS16600	569238..569475	+	238	Protein_541	DUF645 family protein	-
D5R51_RS16605	569689..570693	+	1005	WP_000964925.1	LD-carboxypeptidase	-
D5R51_RS16610	570894..571136	+	243	WP_000107462.1	hypothetical protein	-
D5R51_RS16615	571251..571412	+	162	Protein_544	hypothetical protein	-
D5R51_RS16620	571448..571666	+	219	WP_162892119.1	DUF3709 domain-containing protein	-
D5R51_RS16625	572000..572251	+	252	WP_001250181.1	type II toxin-antitoxin system Phd/YefM family antitoxin	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Integron	blaCARB-7	-	497585..615862	118277

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Toxin-antitoxin system, RelE/ParE toxin family (6-93)

Antitoxin

• Type II toxin-antitoxin system, antitoxin Phd/YefM (1-71)

Sequences

Toxin

Protein

• Length: 106 a.a.
• Molecular weight: 12199.00 Da
• Isoelectric Point: 9.5427

>T292988 WP_001180246.1 NZ_LS997868:c567169-566852 [Vibrio cholerae]
MQNKQYKLSQLAQEHLLKIKHYTIENFAETQWQKYKSTLLSGFQTLADNPGLGKSCEDIYQNGFYFPVGKHMAYYTKEAD
FILIVAVLGQSQLPQKHLKHSRFVS

Nucleotide

• Length: 318 bp

Antitoxin

Protein

• Length: 81 a.a.
• Molecular weight: 8931.22 Da
• Isoelectric Point: 5.6630

>AT292988 WP_000557291.1 NZ_LS997868:c567430-567188 [Vibrio cholerae]
MHTLTANDAKRNFGELLLSAQREPVIISKNSKNTVVVMSIKDFEELEAMKLDYLKHCFESAQKDLDSGKTVDGAAFLNTL

Nucleotide

• Length: 243 bp

Structures

Antitoxin

• AlphaFold DB: A0A366AI09