Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-Phd |
| Location | 561876..562423 | Replicon | chromosome |
| Accession | NZ_LS997868 | ||
| Organism | Vibrio cholerae strain NCTC 30 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0Q0PYS1 |
| Locus tag | D5R51_RS16515 | Protein ID | WP_000229322.1 |
| Coordinates | 562121..562423 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9KM93 |
| Locus tag | D5R51_RS16510 | Protein ID | WP_000861987.1 |
| Coordinates | 561876..562133 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D5R51_RS16460 | 557632..558672 | - | 1041 | WP_119091934.1 | IS481 family transposase | - |
| D5R51_RS16470 | 559212..559372 | + | 161 | Protein_521 | hypothetical protein | - |
| D5R51_RS16475 | 559393..559563 | + | 171 | WP_113600562.1 | DUF3709 domain-containing protein | - |
| D5R51_RS16480 | 559848..560032 | + | 185 | Protein_523 | DUF3709 domain-containing protein | - |
| D5R51_RS16485 | 560029..560262 | + | 234 | WP_119091935.1 | DUF3709 domain-containing protein | - |
| D5R51_RS19005 | 560698..560868 | + | 171 | Protein_525 | DUF645 family protein | - |
| D5R51_RS16500 | 561067..561345 | - | 279 | WP_119091936.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| D5R51_RS16505 | 561342..561626 | - | 285 | WP_000381183.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | - |
| D5R51_RS16510 | 561876..562133 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| D5R51_RS16515 | 562121..562423 | + | 303 | WP_000229322.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| D5R51_RS16520 | 562737..562919 | + | 183 | WP_119091920.1 | DUF645 family protein | - |
| D5R51_RS16525 | 563137..563493 | + | 357 | WP_002033264.1 | hypothetical protein | - |
| D5R51_RS16530 | 563806..563976 | + | 171 | Protein_532 | DUF645 family protein | - |
| D5R51_RS16535 | 564179..564643 | + | 465 | WP_119091937.1 | ASCH domain-containing protein | - |
| D5R51_RS16550 | 565402..566268 | + | 867 | WP_113612726.1 | PSE family carbenicillin-hydrolyzing class A beta-lactamase | - |
| D5R51_RS16560 | 566852..567169 | - | 318 | WP_001180246.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integron | blaCARB-7 | - | 497585..615862 | 118277 | |
| - | flank | IS/Tn | - | - | 557632..558672 | 1040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11737.67 Da Isoelectric Point: 5.1972
>T292987 WP_000229322.1 NZ_LS997868:562121-562423 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q0PYS1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1T4SLM9 |