Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-Phd |
| Location | 550879..551426 | Replicon | chromosome |
| Accession | NZ_LS997868 | ||
| Organism | Vibrio cholerae strain NCTC 30 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A0Q0PYS1 |
| Locus tag | D5R51_RS16370 | Protein ID | WP_000229322.1 |
| Coordinates | 551124..551426 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | Q9KM93 |
| Locus tag | D5R51_RS16365 | Protein ID | WP_000861987.1 |
| Coordinates | 550879..551136 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D5R51_RS16305 | 546245..546586 | + | 342 | WP_119091923.1 | hypothetical protein | - |
| D5R51_RS16310 | 546597..546692 | + | 96 | Protein_498 | DUF3265 domain-containing protein | - |
| D5R51_RS16315 | 546735..547178 | + | 444 | WP_119091924.1 | hypothetical protein | - |
| D5R51_RS16320 | 547142..547285 | + | 144 | WP_119092149.1 | DUF3265 domain-containing protein | - |
| D5R51_RS16325 | 547358..547681 | + | 324 | WP_080483555.1 | DUF3709 domain-containing protein | - |
| D5R51_RS16335 | 548119..548289 | + | 171 | Protein_502 | DUF645 family protein | - |
| D5R51_RS16340 | 548437..548597 | + | 161 | Protein_503 | hypothetical protein | - |
| D5R51_RS16345 | 548618..548788 | + | 171 | WP_113600562.1 | DUF3709 domain-containing protein | - |
| D5R51_RS16350 | 549165..549488 | + | 324 | WP_119091925.1 | DUF3709 domain-containing protein | - |
| D5R51_RS16355 | 549916..550098 | + | 183 | WP_119091920.1 | DUF645 family protein | - |
| D5R51_RS16365 | 550879..551136 | + | 258 | WP_000861987.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| D5R51_RS16370 | 551124..551426 | + | 303 | WP_000229322.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| D5R51_RS16375 | 551599..552246 | + | 648 | WP_119091926.1 | glutathione S-transferase family protein | - |
| D5R51_RS16380 | 552397..552780 | + | 384 | WP_069648821.1 | hypothetical protein | - |
| D5R51_RS16385 | 552871..553032 | + | 162 | WP_142618381.1 | DUF3709 domain-containing protein | - |
| D5R51_RS16390 | 553026..553274 | + | 249 | WP_082069824.1 | DUF3709 domain-containing protein | - |
| D5R51_RS16400 | 553611..554681 | + | 1071 | WP_119091929.1 | hypothetical protein | - |
| D5R51_RS16410 | 554734..554940 | + | 207 | Protein_514 | DUF3709 domain-containing protein | - |
| D5R51_RS16415 | 554934..555182 | + | 249 | WP_162892165.1 | DUF3709 domain-containing protein | - |
| D5R51_RS19090 | 555630..555744 | + | 115 | Protein_516 | ggdef family protein | - |
| D5R51_RS16430 | 555763..555801 | + | 39 | WP_119092150.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integron | blaCARB-7 | - | 497585..615862 | 118277 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11737.67 Da Isoelectric Point: 5.1972
>T292985 WP_000229322.1 NZ_LS997868:551124-551426 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0Q0PYS1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1T4SLM9 |