Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-Phd
Location 550879..551426 Replicon chromosome
Accession NZ_LS997868
Organism Vibrio cholerae strain NCTC 30

Toxin (Protein)


Gene name relE Uniprot ID A0A0Q0PYS1
Locus tag D5R51_RS16370 Protein ID WP_000229322.1
Coordinates 551124..551426 (+) Length 101 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID Q9KM93
Locus tag D5R51_RS16365 Protein ID WP_000861987.1
Coordinates 550879..551136 (+) Length 86 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
D5R51_RS16305 546245..546586 + 342 WP_119091923.1 hypothetical protein -
D5R51_RS16310 546597..546692 + 96 Protein_498 DUF3265 domain-containing protein -
D5R51_RS16315 546735..547178 + 444 WP_119091924.1 hypothetical protein -
D5R51_RS16320 547142..547285 + 144 WP_119092149.1 DUF3265 domain-containing protein -
D5R51_RS16325 547358..547681 + 324 WP_080483555.1 DUF3709 domain-containing protein -
D5R51_RS16335 548119..548289 + 171 Protein_502 DUF645 family protein -
D5R51_RS16340 548437..548597 + 161 Protein_503 hypothetical protein -
D5R51_RS16345 548618..548788 + 171 WP_113600562.1 DUF3709 domain-containing protein -
D5R51_RS16350 549165..549488 + 324 WP_119091925.1 DUF3709 domain-containing protein -
D5R51_RS16355 549916..550098 + 183 WP_119091920.1 DUF645 family protein -
D5R51_RS16365 550879..551136 + 258 WP_000861987.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
D5R51_RS16370 551124..551426 + 303 WP_000229322.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
D5R51_RS16375 551599..552246 + 648 WP_119091926.1 glutathione S-transferase family protein -
D5R51_RS16380 552397..552780 + 384 WP_069648821.1 hypothetical protein -
D5R51_RS16385 552871..553032 + 162 WP_142618381.1 DUF3709 domain-containing protein -
D5R51_RS16390 553026..553274 + 249 WP_082069824.1 DUF3709 domain-containing protein -
D5R51_RS16400 553611..554681 + 1071 WP_119091929.1 hypothetical protein -
D5R51_RS16410 554734..554940 + 207 Protein_514 DUF3709 domain-containing protein -
D5R51_RS16415 554934..555182 + 249 WP_162892165.1 DUF3709 domain-containing protein -
D5R51_RS19090 555630..555744 + 115 Protein_516 ggdef family protein -
D5R51_RS16430 555763..555801 + 39 WP_119092150.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integron blaCARB-7 - 497585..615862 118277


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-91)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-69)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11737.67 Da        Isoelectric Point: 5.1972

>T292985 WP_000229322.1 NZ_LS997868:551124-551426 [Vibrio cholerae]
MVEIIWTEPALSDLNDIAEYIALENVVAAKQLVQTVFTKVERLADFPESGRVPPELEHLNYREVVVNPCRVFYKYDDAKV
RILFVMRAERDLRRLMLTKQ

Download         Length: 303 bp

Antitoxin


Download         Length: 86 a.a.        Molecular weight: 9647.15 Da        Isoelectric Point: 7.3178

>AT292985 WP_000861987.1 NZ_LS997868:550879-551136 [Vibrio cholerae]
MKVELVTSLKRQATKILADLHDTKEPVLITEHGKPSAYLIDVDDYEFMQNRLAILEGIARGERALADGKVVSHQDAKDRM
SKWLK

Download         Length: 258 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0Q0PYS1

Antitoxin

Source ID Structure
AlphaFold DB A0A1T4SLM9

References