Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 29331..29878 Replicon plasmid 3
Accession NZ_LS992194
Organism Escherichia coli isolate Escherichia coli str. TO217

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag ECTO217_RS27885 Protein ID WP_047628495.1
Coordinates 29331..29612 (-) Length 94 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID -
Locus tag ECTO217_RS27890 Protein ID WP_049144636.1
Coordinates 29609..29878 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO217_RS27860 25339..26064 + 726 WP_049144433.1 microcin B17 immunity protein McbE -
ECTO217_RS27865 26061..26792 + 732 WP_000155032.1 ATP-binding cassette domain-containing protein -
ECTO217_RS27870 26796..27359 + 564 WP_000351266.1 pentapeptide repeat-containing protein -
ECTO217_RS27875 27838..28320 - 483 WP_001311056.1 hypothetical protein -
ECTO217_RS27880 28437..29285 - 849 WP_049144635.1 3'-5' exonuclease -
ECTO217_RS27885 29331..29612 - 282 WP_047628495.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ECTO217_RS27890 29609..29878 - 270 WP_049144636.1 hypothetical protein Antitoxin
ECTO217_RS27900 30792..31649 - 858 WP_016240488.1 incFII family plasmid replication initiator RepA -
ECTO217_RS27905 31642..31716 - 75 WP_001365705.1 RepA leader peptide Tap -
ECTO217_RS27915 31961..32209 - 249 WP_000083839.1 replication regulatory protein RepA -
ECTO217_RS27920 32494..32643 - 150 WP_001312851.1 type I toxin-antitoxin system Hok family toxin -
- 32688..32747 + 60 NuclAT_2 - -
- 32688..32747 + 60 NuclAT_2 - -
- 32688..32747 + 60 NuclAT_2 - -
- 32688..32747 + 60 NuclAT_2 - -
ECTO217_RS27930 32890..33363 - 474 WP_016240489.1 hypothetical protein -
ECTO217_RS27935 33518..34108 - 591 WP_049144557.1 DUF2726 domain-containing protein -
ECTO217_RS27940 34146..34355 - 210 WP_049144558.1 hemolysin expression modulator Hha -
ECTO217_RS27945 34401..34862 - 462 WP_032283779.1 thermonuclease family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..86367 86367


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-92)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 10877.57 Da        Isoelectric Point: 8.0410

>T292975 WP_047628495.1 NZ_LS992194:c29612-29331 [Escherichia coli]
MMEVFWTILASQDRKRIREYIAEQNLMAAIELDERIGYSACSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKV
YILRVLHTAQKWP

Download         Length: 282 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10266.61 Da        Isoelectric Point: 7.2057

>AT292975 WP_049144636.1 NZ_LS992194:c29878-29609 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQIEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References