Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 98370..98895 | Replicon | plasmid 2 |
| Accession | NZ_LS992193 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO217 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | ECTO217_RS27435 | Protein ID | WP_001159871.1 |
| Coordinates | 98370..98675 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | ECTO217_RS27440 | Protein ID | WP_000813630.1 |
| Coordinates | 98677..98895 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO217_RS27420 | 94332..95498 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| ECTO217_RS27425 | 96086..96841 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| ECTO217_RS27430 | 97563..98369 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| ECTO217_RS27435 | 98370..98675 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| ECTO217_RS27440 | 98677..98895 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| ECTO217_RS27450 | 99455..99685 | + | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| ECTO217_RS27455 | 99682..100098 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| ECTO217_RS27460 | 100173..101738 | + | 1566 | WP_001128474.1 | AAA family ATPase | - |
| ECTO217_RS27465 | 101723..102745 | + | 1023 | WP_000361402.1 | helicase UvrD | - |
| ECTO217_RS27470 | 102999..103685 | - | 687 | Protein_128 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | iutA / iucD | 1..128948 | 128948 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T292969 WP_001159871.1 NZ_LS992193:c98675-98370 [Escherichia coli]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |