Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4760152..4760953 Replicon chromosome
Accession NZ_LS992192
Organism Escherichia coli isolate Escherichia coli str. TO217

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag ECTO217_RS24245 Protein ID WP_001094436.1
Coordinates 4760576..4760953 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag ECTO217_RS24240 Protein ID WP_015953067.1
Coordinates 4760152..4760529 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO217_RS24205 4756063..4756743 + 681 WP_001282919.1 WYL domain-containing protein -
ECTO217_RS24210 4756891..4757568 + 678 WP_001097301.1 hypothetical protein -
ECTO217_RS24215 4757574..4757807 + 234 WP_001278287.1 DUF905 family protein -
ECTO217_RS24220 4757897..4758715 + 819 WP_001175163.1 DUF945 domain-containing protein -
ECTO217_RS24225 4758807..4759292 + 486 WP_029700724.1 antirestriction protein -
ECTO217_RS24230 4759307..4759783 + 477 WP_001186756.1 RadC family protein -
ECTO217_RS24235 4759852..4760073 + 222 WP_000692312.1 DUF987 domain-containing protein -
ECTO217_RS24240 4760152..4760529 + 378 WP_015953067.1 type IV toxin-antitoxin system toxin CbtA Antitoxin
ECTO217_RS24245 4760576..4760953 + 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
ECTO217_RS24250 4760950..4761438 + 489 WP_000761714.1 hypothetical protein -
ECTO217_RS24255 4761450..4761647 + 198 WP_000839254.1 DUF957 domain-containing protein -
ECTO217_RS24260 4761732..4762427 + 696 Protein_4641 DUF4942 domain-containing protein -
ECTO217_RS24265 4762491..4763246 - 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
ECTO217_RS24270 4763243..4764742 - 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
ECTO217_RS24275 4764833..4764994 + 162 Protein_4644 DUF4942 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T292958 WP_001094436.1 NZ_LS992192:4760576-4760953 [Escherichia coli]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT292958 WP_015953067.1 NZ_LS992192:4760152-4760529 [Escherichia coli]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References