Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4456312..4457147 | Replicon | chromosome |
| Accession | NZ_LS992192 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO217 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | ECTO217_RS22560 | Protein ID | WP_000854759.1 |
| Coordinates | 4456312..4456689 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | ECTO217_RS22565 | Protein ID | WP_001295723.1 |
| Coordinates | 4456779..4457147 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO217_RS22525 | 4452250..4452426 | - | 177 | Protein_4331 | helix-turn-helix domain-containing protein | - |
| ECTO217_RS22530 | 4452618..4453364 | - | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| ECTO217_RS22535 | 4453379..4454920 | - | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| ECTO217_RS28525 | 4455376..4455534 | - | 159 | WP_001467148.1 | hypothetical protein | - |
| ECTO217_RS22550 | 4455634..4455810 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| ECTO217_RS22555 | 4455827..4456315 | - | 489 | WP_000761690.1 | hypothetical protein | - |
| ECTO217_RS22560 | 4456312..4456689 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| ECTO217_RS22565 | 4456779..4457147 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| ECTO217_RS22570 | 4457310..4457531 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| ECTO217_RS22575 | 4457594..4458070 | - | 477 | WP_001186775.1 | RadC family protein | - |
| ECTO217_RS22580 | 4458086..4458559 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| ECTO217_RS22590 | 4458901..4459719 | - | 819 | WP_001234738.1 | DUF945 domain-containing protein | - |
| ECTO217_RS22600 | 4459874..4460032 | - | 159 | WP_001323397.1 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T292956 WP_000854759.1 NZ_LS992192:c4456689-4456312 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT292956 WP_001295723.1 NZ_LS992192:c4457147-4456779 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |