Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yjhX-yjhQ/YjhX-GNAT |
| Location | 4422357..4423177 | Replicon | chromosome |
| Accession | NZ_LS992192 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO217 | ||
Toxin (Protein)
| Gene name | yjhX | Uniprot ID | B6I030 |
| Locus tag | ECTO217_RS22390 | Protein ID | WP_001054379.1 |
| Coordinates | 4422357..4422614 (+) | Length | 86 a.a. |
Antitoxin (Protein)
| Gene name | yjhQ | Uniprot ID | - |
| Locus tag | ECTO217_RS22395 | Protein ID | WP_000123957.1 |
| Coordinates | 4422626..4423177 (+) | Length | 184 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO217_RS22370 | 4417904..4418884 | + | 981 | WP_000991462.1 | 9-O-acetyl-N-acetylneuraminic acid deacetylase | - |
| ECTO217_RS22375 | 4419467..4420573 | - | 1107 | Protein_4301 | helicase YjhR | - |
| ECTO217_RS22380 | 4420636..4421783 | + | 1148 | WP_085949154.1 | IS3-like element ISEc52 family transposase | - |
| ECTO217_RS22385 | 4421816..4421980 | + | 165 | Protein_4303 | GNAT family N-acetyltransferase | - |
| ECTO217_RS22390 | 4422357..4422614 | + | 258 | WP_001054379.1 | YjhX family toxin | Toxin |
| ECTO217_RS22395 | 4422626..4423177 | + | 552 | WP_000123957.1 | N-acetyltransferase | Antitoxin |
| ECTO217_RS22400 | 4423229..4423975 | + | 747 | WP_000354249.1 | class I SAM-dependent methyltransferase | - |
| ECTO217_RS22405 | 4424103..4424363 | + | 261 | WP_000077645.1 | hypothetical protein | - |
| ECTO217_RS28520 | 4424401..4424517 | + | 117 | Protein_4308 | VOC family protein | - |
| ECTO217_RS22410 | 4424762..4425883 | + | 1122 | WP_000010833.1 | M42 family metallopeptidase | - |
| ECTO217_RS22415 | 4425880..4426158 | + | 279 | WP_000722973.1 | PTS sugar transporter subunit IIB | - |
| ECTO217_RS22420 | 4426170..4427483 | + | 1314 | WP_000460845.1 | galactitol-specific PTS transporter subunit IIC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | fimE | 4410978..4431398 | 20420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 86 a.a. Molecular weight: 9568.07 Da Isoelectric Point: 11.1381
>T292955 WP_001054379.1 NZ_LS992192:4422357-4422614 [Escherichia coli]
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
MNLSRQEQRTLHVLAKGGRIAHVRDSSGRVTSVECYSREGLLLTDCTLAVFKKLKTKKLIKSVNGQPYRINTTGLNNVRA
QLDNR
Download Length: 258 bp
Antitoxin
Download Length: 184 a.a. Molecular weight: 20358.34 Da Isoelectric Point: 6.4182
>AT292955 WP_000123957.1 NZ_LS992192:4422626-4423177 [Escherichia coli]
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
MTAHHFTFQITDESDASDIREVETRAFGFSKEADLTASLLEDESARPALSLLARHEGKAVGHILFTRATFKGEMDSPLMH
ILAPLAVIPEYQGMGVGGRLIRTGIEHLRLMGCQTVFVLGHATYYPRHGFEPCAGDKGYPAPYPIPEEHKACWMMQALTA
QPMNVTGHIQCAQALMKPEHWRE
Download Length: 552 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|