Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1983435..1984266 Replicon chromosome
Accession NZ_LS992192
Organism Escherichia coli isolate Escherichia coli str. TO217

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag ECTO217_RS09705 Protein ID WP_000854815.1
Coordinates 1983435..1983809 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag ECTO217_RS09710 Protein ID WP_001280918.1
Coordinates 1983898..1984266 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO217_RS09665 1978831..1979997 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
ECTO217_RS09670 1980116..1980589 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
ECTO217_RS09675 1980787..1981845 + 1059 WP_001200889.1 FUSC family protein -
ECTO217_RS09680 1982017..1982346 + 330 WP_000450409.1 DUF496 family protein -
ECTO217_RS09685 1982447..1982629 - 183 WP_001296208.1 hypothetical protein -
ECTO217_RS09690 1982683..1982829 + 147 Protein_1864 transposase domain-containing protein -
ECTO217_RS09695 1983118..1983231 - 114 WP_001161660.1 DUF957 domain-containing protein -
ECTO217_RS09700 1983244..1983438 - 195 WP_000988600.1 hypothetical protein -
ECTO217_RS09705 1983435..1983809 - 375 WP_000854815.1 type IV toxin-antitoxin system toxin CbtA Toxin
ECTO217_RS09710 1983898..1984266 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
ECTO217_RS09715 1984282..1984926 - 645 WP_000086752.1 hypothetical protein -
ECTO217_RS09720 1984945..1985166 - 222 WP_000692345.1 DUF987 domain-containing protein -
ECTO217_RS09725 1985229..1985705 - 477 WP_001186200.1 RadC family protein -
ECTO217_RS09730 1985721..1986194 - 474 WP_001542276.1 antirestriction protein -
ECTO217_RS09735 1986288..1986533 - 246 WP_001164966.1 hypothetical protein -
ECTO217_RS09740 1986533..1987351 - 819 WP_001542275.1 DUF945 domain-containing protein -
ECTO217_RS09750 1987572..1987982 - 411 WP_000846703.1 hypothetical protein -
ECTO217_RS09755 1987998..1988348 - 351 Protein_1876 hypothetical protein -
ECTO217_RS09765 1988431..1989177 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 1935209..1993369 58160


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T292944 WP_000854815.1 NZ_LS992192:c1983809-1983435 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT292944 WP_001280918.1 NZ_LS992192:c1984266-1983898 [Escherichia coli]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References