Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 807179..808013 | Replicon | chromosome |
Accession | NZ_LS992192 | ||
Organism | Escherichia coli isolate Escherichia coli str. TO217 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | S1PLF5 |
Locus tag | ECTO217_RS03925 | Protein ID | WP_000854690.1 |
Coordinates | 807179..807556 (-) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | S1P7N8 |
Locus tag | ECTO217_RS03930 | Protein ID | WP_001305076.1 |
Coordinates | 807645..808013 (-) | Length | 123 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECTO217_RS28285 | 803573..803728 | - | 156 | WP_000729638.1 | hypothetical protein | - |
ECTO217_RS03900 | 804160..805093 | - | 934 | Protein_763 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
ECTO217_RS03905 | 805086..805481 | - | 396 | WP_000208384.1 | type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein | - |
ECTO217_RS03910 | 805550..806395 | - | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
ECTO217_RS03915 | 806480..806677 | - | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
ECTO217_RS03920 | 806694..807182 | - | 489 | WP_000761699.1 | hypothetical protein | - |
ECTO217_RS03925 | 807179..807556 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
ECTO217_RS03930 | 807645..808013 | - | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
ECTO217_RS03935 | 808063..808707 | - | 645 | WP_000094916.1 | hypothetical protein | - |
ECTO217_RS03940 | 808726..808947 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
ECTO217_RS03945 | 809010..809486 | - | 477 | WP_001186726.1 | RadC family protein | - |
ECTO217_RS03950 | 809502..809987 | - | 486 | WP_000849565.1 | antirestriction protein | - |
ECTO217_RS03955 | 810042..810860 | - | 819 | WP_001234620.1 | DUF945 domain-containing protein | - |
ECTO217_RS03965 | 810961..811194 | - | 234 | WP_000902034.1 | DUF905 family protein | - |
ECTO217_RS03970 | 811273..811728 | - | 456 | WP_000581502.1 | hypothetical protein | - |
ECTO217_RS03975 | 811804..812931 | - | 1128 | Protein_777 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF | 785562..809987 | 24425 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T292941 WP_000854690.1 NZ_LS992192:c807556-807179 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT292941 WP_001305076.1 NZ_LS992192:c808013-807645 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|