Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 76527..77170 | Replicon | plasmid 2 |
| Accession | NZ_LS992191 | ||
| Organism | Escherichia coli isolate Escherichia coli str. TO148 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | C7S9Y5 |
| Locus tag | ECTO148_RS26025 | Protein ID | WP_001034046.1 |
| Coordinates | 76527..76943 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | V0SR71 |
| Locus tag | ECTO148_RS26030 | Protein ID | WP_001261278.1 |
| Coordinates | 76940..77170 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTO148_RS26010 | 71664..72080 | - | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| ECTO148_RS26015 | 72077..72307 | - | 231 | WP_001261286.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | - |
| ECTO148_RS26020 | 72688..76482 | + | 3795 | WP_001144732.1 | hypothetical protein | - |
| ECTO148_RS26025 | 76527..76943 | - | 417 | WP_001034046.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| ECTO148_RS26030 | 76940..77170 | - | 231 | WP_001261278.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| ECTO148_RS26035 | 77435..77935 | + | 501 | WP_000528932.1 | hypothetical protein | - |
| ECTO148_RS26040 | 77948..78721 | + | 774 | WP_000905949.1 | hypothetical protein | - |
| ECTO148_RS26045 | 78932..80545 | - | 1614 | WP_000080195.1 | IS66-like element ISEc23 family transposase | - |
| ECTO148_RS26050 | 80576..80926 | - | 351 | WP_000624722.1 | IS66 family insertion sequence element accessory protein TnpB | - |
| ECTO148_RS26055 | 80923..81348 | - | 426 | WP_000422741.1 | IS66 family insertion sequence hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) | - | 1..133139 | 133139 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14978.31 Da Isoelectric Point: 6.7113
>T292936 WP_001034046.1 NZ_LS992191:c76943-76527 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
VNKIYMLDTNICSFIMREQPEAVLKNLEQAVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCARLDAILPWDRA
AVDATTEVKVALRLAGTPIGPNDTAIAGHAIATGAILVTNNVREFERVPGLVLEDWAG
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9NXF9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0SR71 |