Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 71664..72307 Replicon plasmid 2
Accession NZ_LS992191
Organism Escherichia coli isolate Escherichia coli str. TO148

Toxin (Protein)


Gene name vagD Uniprot ID V0UN72
Locus tag ECTO148_RS26010 Protein ID WP_001034044.1
Coordinates 71664..72080 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID B1P7N7
Locus tag ECTO148_RS26015 Protein ID WP_001261286.1
Coordinates 72077..72307 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO148_RS25985 67470..67777 + 308 Protein_78 type II toxin-antitoxin system ParD family antitoxin -
ECTO148_RS25995 68066..68763 + 698 Protein_79 IS1 family transposase -
ECTO148_RS26000 69017..70039 - 1023 WP_000361402.1 helicase UvrD -
ECTO148_RS26005 70024..71589 - 1566 WP_001128474.1 AAA family ATPase -
ECTO148_RS26010 71664..72080 - 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin Toxin
ECTO148_RS26015 72077..72307 - 231 WP_001261286.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
ECTO148_RS26020 72688..76482 + 3795 WP_001144732.1 hypothetical protein -
ECTO148_RS26025 76527..76943 - 417 WP_001034046.1 type II toxin-antitoxin system VapC family toxin -
ECTO148_RS26030 76940..77170 - 231 WP_001261278.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) - 1..133139 133139
- flank IS/Tn - - 68260..68763 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15232.66 Da        Isoelectric Point: 6.8536

>T292935 WP_001034044.1 NZ_LS992191:c72080-71664 [Escherichia coli]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8747.86 Da        Isoelectric Point: 4.3775

>AT292935 WP_001261286.1 NZ_LS992191:c72307-72077 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFLELEKADPDFMTEREDVVSDEGRVNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CHW1

Antitoxin

Source ID Structure
AlphaFold DB A0A829CKZ6

References