Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/RHH(antitoxin)
Location 64654..65213 Replicon plasmid 2
Accession NZ_LS992191
Organism Escherichia coli isolate Escherichia coli str. TO148

Toxin (Protein)


Gene name relE Uniprot ID V0SVC8
Locus tag ECTO148_RS25960 Protein ID WP_000421272.1
Coordinates 64938..65213 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID V0SRR3
Locus tag ECTO148_RS25955 Protein ID WP_001387467.1
Coordinates 64654..64938 (+) Length 95 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECTO148_RS25925 60117..60557 - 441 Protein_68 zinc-binding dehydrogenase -
ECTO148_RS25935 60958..61848 + 891 WP_001077068.1 dihydrodipicolinate synthase family protein -
ECTO148_RS25940 61873..62253 + 381 WP_000710783.1 Rid family detoxifying hydrolase -
ECTO148_RS25945 62286..63251 + 966 WP_001022265.1 2-keto-3-deoxygluconate transporter -
ECTO148_RS25950 63297..64049 - 753 WP_000562172.1 IclR family transcriptional regulator -
ECTO148_RS25955 64654..64938 + 285 WP_001387467.1 ribbon-helix-helix domain-containing protein Antitoxin
ECTO148_RS25960 64938..65213 + 276 WP_000421272.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
ECTO148_RS25965 65319..65612 + 294 WP_001105060.1 hypothetical protein -
ECTO148_RS25970 65647..65775 - 129 Protein_76 IS481 family transposase -
ECTO148_RS25975 65808..66977 - 1170 WP_001072355.1 hypothetical protein -
ECTO148_RS25985 67470..67777 + 308 Protein_78 type II toxin-antitoxin system ParD family antitoxin -
ECTO148_RS25995 68066..68763 + 698 Protein_79 IS1 family transposase -
ECTO148_RS26000 69017..70039 - 1023 WP_000361402.1 helicase UvrD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / aac(6')-Ib-cr / blaOXA-1 / blaCTX-M-15 / aadA5 / qacE / sul1 / mph(A) - 1..133139 133139
- flank IS/Tn - - 68260..68763 503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-90)

Antitoxin

Ribbon-helix-helix protein, CopG

(14-51)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10749.45 Da        Isoelectric Point: 10.0871

>T292934 WP_000421272.1 NZ_LS992191:64938-65213 [Escherichia coli]
MELKWTSKALSDLSRLFDFLVLASKPAAARTVQSLTQAPVILLTHPRMGEQLFQFEPREVRRIFAGEYEIRYEINGQTIY
VLRLWHTRENR

Download         Length: 276 bp

Antitoxin


Download         Length: 95 a.a.        Molecular weight: 10460.87 Da        Isoelectric Point: 5.6558

>AT292934 WP_001387467.1 NZ_LS992191:64654-64938 [Escherichia coli]
MQMKNNAAQATKVITAHVPLPMADKVDQMAARLERSRGWVIKQALSAWLAQEEERNRLTLEALDDVTSGQVIDHQAVQAW
SDSLSTDNPLPVPR

Download         Length: 285 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0SVC8

Antitoxin

Source ID Structure
AlphaFold DB A0A0E0Y880

References